SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256832292|ref|YP_003161019.1| from Jonesia denitrificans DSM 20603

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256832292|ref|YP_003161019.1|
Domain Number 1 Region: 21-274
Classification Level Classification E-value
Superfamily Cgl1923-like 1.06e-73
Family Cgl1923-like 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256832292|ref|YP_003161019.1|
Sequence length 310
Comment hypothetical protein Jden_1060 [Jonesia denitrificans DSM 20603]
Sequence
MSSDLYDFHKDTYDELRTRTETSAVGPVLVLALRPLVDAGHVTEIIAEHLTAHGNPRPFA
TFDHDQLIDYHARRPTMVFDVHHWTEYRQPHISLDLLHDAEGTDYLLLHGLEPDRRWDGF
TQAVLDLIEDFNVSLVVSAYGLPMGIPHTREHGAILHATRETLLTAQPKWVGKVEVPATV
SNRIEFELGLRHRDAVGIAAHVPHYLIQSQYYPSALTAVTRVEDVTGLDLASADIAQAAV
EARIEVDRQVAQSPDIHEVVTGLENQYDAFMAAKDRESLLADDPLLPSADELGAEFEAFL
QREWRKGQSH
Download sequence
Identical sequences C7R3I0
471856.Jden_1060 gi|256832292|ref|YP_003161019.1| WP_015771344.1.34072 WP_015771344.1.39474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]