SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256832994|ref|YP_003161721.1| from Jonesia denitrificans DSM 20603

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256832994|ref|YP_003161721.1|
Domain Number 1 Region: 4-296
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 2.35e-75
Family ATP synthase (F1-ATPase), gamma subunit 0.0000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256832994|ref|YP_003161721.1|
Sequence length 299
Comment ATP synthase F1 subunit gamma [Jonesia denitrificans DSM 20603]
Sequence
MAGNQRVYKARIKSTQSLKKIFRAMELIAASRIGKARARVAATVPYADAITRAVGAVATH
SATDHPLTSERHDTNRVAVLVITADRGMAGAYSASALREAETLIERLTDEGKEVDLYVAG
RRGVSFYQFRDREMVKTWTGASDSPTVDIAEDMADTLLSAFLADANKGGVSALHVVYTQF
VNMVTQRPRVVRLLPLEVVDAPDESDEPVEAYPLYDFEPSAEEVLDALLPRYVRSRIFSF
ILEASASELAARQSAMHTATDNAQELIKTYTRLANSARQAEITQEISEIVSGADALAGS
Download sequence
Identical sequences C7QZC0
gi|256832994|ref|YP_003161721.1| 471856.Jden_1775 WP_015772046.1.34072 WP_015772046.1.39474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]