SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256833075|ref|YP_003161802.1| from Jonesia denitrificans DSM 20603

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256833075|ref|YP_003161802.1|
Domain Number 1 Region: 13-148
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.53e-29
Family Phosphoglucomutase, first 3 domains 0.00019
Further Details:      
 
Domain Number 2 Region: 182-290
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 9.81e-29
Family Phosphoglucomutase, first 3 domains 0.00014
Further Details:      
 
Domain Number 3 Region: 310-401
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.49e-24
Family Phosphoglucomutase, first 3 domains 0.0018
Further Details:      
 
Domain Number 4 Region: 405-496
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.00000000000000436
Family Phosphoglucomutase, C-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256833075|ref|YP_003161802.1|
Sequence length 502
Comment phosphomannomutase [Jonesia denitrificans DSM 20603]
Sequence
MSAHKPGVDLAEIIKSYDVRGVVPQQLNAEVAQAIGAAFATVVVIPDAGDRADQTPADIV
AAGGRRPQVVVGRDMRESGPELVAAFARGLTAAGVDVLDIGLCSTDGLYHASGVWGIPGA
MFTASHNPAQYNGMKLCRAGARPVGQDSGLGRIRELAQQYVAYGLPGEATQLGQVSRREM
LGEYASFLRSLVDISGIRPLKVVVDAGNGMGGLTVPAVFGDAAGLPALPLDIVPLYFELD
GSFPNHEANPLDPKNLVDLQRAVVEHGADIGLAFDGDADRCFVVDEQGRAVSPSAITSLV
GLREVAKEREAGRDPVVIHNLITSRAVPDFLEAAGARVVRTRVGHSFIKAEMASHEAIFG
GEHSAHYYFRDFFFADTGMLAALHVLAALGSQPHPLSAIADMYEPYVASGEINSTVRDVP
AARARIVDAYVTNQGGGEVVVDELDGLTVSHWEGHPQWWFNVRASNTEPLLRLNVEAADE
DMMVKVRDDVLGLIRGTEGEQE
Download sequence
Identical sequences C7QZU1
WP_015772127.1.34072 WP_015772127.1.39474 471856.Jden_1856 gi|256833075|ref|YP_003161802.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]