SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256833254|ref|YP_003161981.1| from Jonesia denitrificans DSM 20603

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256833254|ref|YP_003161981.1|
Domain Number 1 Region: 3-130
Classification Level Classification E-value
Superfamily FlgN-like 0.000000929
Family FlgN-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256833254|ref|YP_003161981.1|
Sequence length 161
Comment FlgN family protein [Jonesia denitrificans DSM 20603]
Sequence
MDLSTLNSLLWNERQLLELLLFKLEEEQLLLAAGKSRWLSHATREVENVLEQIRGAELAR
EVETTHVAAQLGLPTHATLLDICERAEDPWGELLTSHRQALLTLVSEIDALSTGNKELLT
TAQRAISETIAHYQRDEKTYDHTGATRSTTDSPAQIFDQSL
Download sequence
Identical sequences C7R0L4
471856.Jden_2040 WP_015772306.1.34072 WP_015772306.1.39474 gi|256833254|ref|YP_003161981.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]