SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256833730|ref|YP_003162457.1| from Jonesia denitrificans DSM 20603

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256833730|ref|YP_003162457.1|
Domain Number 1 Region: 65-150
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 9.55e-23
Family Ribosomal protein L9 C-domain 0.00029
Further Details:      
 
Domain Number 2 Region: 5-60
Classification Level Classification E-value
Superfamily L9 N-domain-like 2.62e-16
Family Ribosomal protein L9 N-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256833730|ref|YP_003162457.1|
Sequence length 150
Comment 50S ribosomal protein L9 [Jonesia denitrificans DSM 20603]
Sequence
MATNKLILTHEVDKLGVAGDVVEVKAGYARNYLIPRRLATPWTKGGEAQVEAIRRARKAR
EVANLDDARALRDAVEAEGVTVTAAASKEGRLFGAVSTKTIADAVAAKGHRIDRRKIQVT
DAIKSTGDYTVTVRIHPEVSAKIKVKVVAE
Download sequence
Identical sequences C7R3A6
gi|256833730|ref|YP_003162457.1| WP_015772765.1.34072 WP_015772765.1.39474 471856.Jden_2522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]