SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|241662341|ref|YP_002980701.1| from Ralstonia pickettii 12D

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|241662341|ref|YP_002980701.1|
Domain Number 1 Region: 163-431
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 6.93e-58
Family Tricorn protease N-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 41-164
Classification Level Classification E-value
Superfamily TolB, N-terminal domain 1.57e-32
Family TolB, N-terminal domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|241662341|ref|YP_002980701.1|
Sequence length 434
Comment translocation protein TolB [Ralstonia pickettii 12D]
Sequence
MNMMRTMWIPMFRRAAQALLLTAASVGVAHAQLNVEISGVGASQYPIAIANFQGEAQAPQ
NLSAIVRADLARSGRFSNVDVAGAVVPESPAPDLGAWKSKGAAAFVGGTVTRNGDRYEIR
FRLYDTAKGESLGGLSLTRGPGQLRLAAHEIADYIYQKLIGERGVFATRLSYVSKVGRRF
QLQISDSDGANPQIALTSNEPIISPSWSPDGTKVAYVSFESKKPVVYVHDLVAGRRTVIS
NQKGNNSAPAWSPDGRHVAVSLSRDGNTQVYLVNADGSGLRRLSRSSAIDTEPSFSPDGR
YIYFTSDRGGAPQIYRMSVDGEEAGAAQRVTFKGNYNTSPRVSPDGKLLAYISRVGGAFR
LYTQDLSNGDVNALTDTSNDESPSFAANGKFILYATRVGGKSVLAAVSTDGRTRQVLSLQ
AGEVREPAWGPFMQ
Download sequence
Identical sequences A0A2A4A5G1 C6BE69
gi|241662341|ref|YP_002980701.1| 428406.Rpic12D_0728 WP_012761463.1.7259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]