SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|241664750|ref|YP_002983110.1| from Ralstonia pickettii 12D

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|241664750|ref|YP_002983110.1|
Domain Number 1 Region: 639-1117
Classification Level Classification E-value
Superfamily ALDH-like 8.12e-129
Family ALDH-like 0.000000234
Further Details:      
 
Domain Number 2 Region: 266-621
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 5.49e-121
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000000247
Further Details:      
 
Domain Number 3 Region: 92-265
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 9.15e-65
Family N-terminal domain of bifunctional PutA protein 0.0000000952
Further Details:      
 
Domain Number 4 Region: 3-45
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00000000133
Family PutA pre-N-terminal region-like 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|241664750|ref|YP_002983110.1|
Sequence length 1326
Comment trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Ralstonia pickettii 12D]
Sequence
MATTTLGVKLDDASRERLKRVAQSIDRTPHWLIKQAIFTYLDQVERGQLPTDANGTAADG
LPSAAAAVSDVHEGDEPAVQPFLEFAQSVQPQSVLRAAITAAYRRPETEAIPMLLEQARL
PGALASEAKQLARDLAGKLRTQKVGTGREGLVQGLIQEFSLSSQEGVALMCLAEALLRIP
DKATRDALIRDKISNGNWHSHLGQSPSLFVNAATWGLLLTGKLVATHNEAGLSKALTRII
GKSGEPLIRKGVDMAMRLMGEQFVTGETISEALANARKFEAEGFRYSYDMLGEAAMTEED
AQRYLASYEQAIRAIGQASGGRGIYEGPGISIKLSALHPRYSRAQYDRTINELYPRVKAL
AMLAREYDIGINIDAEEADRLELSLDLLERLCFAPELAGWNGIGFVVQGYQKRCPFVLDY
IIDLARRSKHRLMIRLVKGAYWDSEIKRAQVDGLEGYPVYTRKVYTDVSYLACARKLLAA
PEAIFPQFATHNAHTLAAIYHMAGQNYYPGQYEFQCLHGMGEPLYEQVVGNKPGKLNRPC
RIYAPVGTHETLLAYLVRRLLENGANTSFVNRIADESIPLDDLVADPVAVVEKMHADEGT
LGLPHPKIPLPRALYGDVRANSSGIDLANEQRLASLSSALLAGTSTVWSAEPTIGDAPYV
GGPSQLRQPVRNPSDLRDVVGHVTEATEADVDAALSAATAAAPIWQATPPEARAALLDRA
ADLMEGEMQHLMGLIIREAGKTLSNAIAEVREAVDFLRYYAAQVRGGFSNDTHRPLGPVV
CISPWNFPLAIFTGQVSAALAAGNPVLAKPAEQTPLIAAQAVRILREAGVPAGAVQLLPG
RGETVGAALVKDVRTKGVMFTGSTEVARILQRTLAGRLDANGAPIPLIAETGGQNAMIVD
SSALAEQVVADVLSSAFDSAGQRCSALRVLCLQDDVADRVLAMLKGGMAELAMGNPDRLS
VDVGPVIDAEARDNIVGHIEAMRAKGRRVHQAPVPAACAHGTFVPPTVIELDSLSDLTRE
IFGPVLHVVRWKRSADNTGLTKLIEQINGTGYGLTLGIHTRIDETIAHVVDRAHVGNLYV
NRNIVGAVVGVQPFGGEGLSGTGPKAGGPLYLLRLLSTCPQDAMRTALQLTAGAGTEVDT
DARRALLAPFDALTEWARKQSPELASLCERLAAASATGATATLPGPTGERNTYTLLPREA
VLCVAADPADWLRQLAAILAVGSLAVVQENPAIEAVLRGLPAAVQSRVRVVGSTDEAAFD
AVLHHGDSDHLRAICEGLARRAGPIVGVQGLPHGGEGLALERLLIERSLSVNTAAAGGNA
SLMTIG
Download sequence
Identical sequences A0A2A4A653 C6BH64
WP_015855926.1.7259 428406.Rpic12D_3171 gi|241664750|ref|YP_002983110.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]