SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|241665350|ref|YP_002983709.1| from Ralstonia pickettii 12D

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|241665350|ref|YP_002983709.1|
Domain Number 1 Region: 348-471
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.42e-24
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.072
Further Details:      
 
Domain Number 2 Region: 44-206,255-315
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 9.42e-17
Family Tricorn protease N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|241665350|ref|YP_002983709.1|
Sequence length 472
Comment coagulation factor 5/8 type domain-containing protein [Ralstonia pickettii 12D]
Sequence
MRNPLLSLDIIASAAFALFSATAQASCVVNPTTQSNSTFPASLTGKLAYHSYVSYGDGTS
QIFIYDFAARTLTQVSNTTWGIQDPMNAVFSPDGKWLAFMGIKNNAWNVFFWQVGTSNLP
INLTNSTGQTRNEDPKFSADGKSLLFKQNGDVMQAALSYTSSGPVFTSVVNLTRTAPGVE
NSMPFATPDGTAVYYATGTGSGMGLYKQTIGSTTNVAFDAPAGLATYYPIVRADGTVFYA
RWLDATSQADQIYTKVNPSDVPNQLPLNDCNSNNSDPSPVNGTNYVFFSSTTAGGYQLYL
GDATTGQRWSLSQFGVNSDTTKAKLGSNYYAGTTVAAQAVTLLSQGKPASASSSYSPSFG
PAYAFDGNTTSTRWDSIEGSAAGTQWLKVDLGSIRTITGVDLYWDAGAKVYSIQTSNDGV
NWTSIYSTSKGAAWGHVSLANLKGSGRYVRMYGTQRATQWGYSLDEMQVWGY
Download sequence
Identical sequences B2UK38 C6BLS9
402626.Rpic_4855 428406.Rpic12D_3778 gi|187927021|ref|YP_001893366.1| gi|241665350|ref|YP_002983709.1| WP_012430814.1.43321 WP_012430814.1.7259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]