SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|241664911|ref|YP_002983271.1| from Ralstonia pickettii 12D

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|241664911|ref|YP_002983271.1|
Domain Number 1 Region: 4-275
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.55e-99
Family Methylenetetrahydrofolate reductase 0.000000531
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|241664911|ref|YP_002983271.1|
Sequence length 276
Comment 5,10-methylenetetrahydrofolate reductase [Ralstonia pickettii 12D]
Sequence
MQDRQFSFEFFPPKTAEGAEKLRNTRAQLSPLKPRFISVTFGAGGTTQQGTLDAVVEIQR
EGIEAAPHLSCVGSSRESIRGILNTYREHGIRRIVALRGDMPSGMGEIGEFRFANELVEF
IRQETGEAFHIEVAAYPEYHPQSRSARHDLENFARKVKAGADSAITQYFFNADAYFQFVD
DARKLGVDVPIVPGIMPITNSSQLMRFSEMCGAEVPRWIAKRLEGFGDDRESIRAFGLDV
VTAMCDRLLQGGAPGLHFYTLNAAGSTRAIWQRLGL
Download sequence
Identical sequences A0A1C0XC17 A0A1I5UKG7 C6BI03
428406.Rpic12D_3335 WP_015856052.1.34768 WP_015856052.1.7259 WP_015856052.1.75201 gi|241664911|ref|YP_002983271.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]