SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|241664920|ref|YP_002983280.1| from Ralstonia pickettii 12D

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|241664920|ref|YP_002983280.1|
Domain Number - Region: 20-107
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.000424
Family D-glucarate dehydratase-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|241664920|ref|YP_002983280.1|
Sequence length 278
Comment hypothetical protein Rpic12D_3344 [Ralstonia pickettii 12D]
Sequence
MVTQPIAIAVAPNGARKTHADHPALPITPDELAACARQCVDAGAAMLHLHVRRPDGTHSL
EPGDYRPAIAAVRHAVGDALVIQITTEAVGIYTPEQQMASVRALQPEAISAALRELAPDA
AHEAEAARFFGELAAARTAIQYILYSADDVARYRDLRTRGVLPDTSHWVLFVLGRYSAGQ
HSDPTDLLQFLQAWADGGDLTANVPWAMCAFGPREAECALTAALLGGHARLGFENNMALP
DGSTAPDNAALVTNLRRHLDALHRPLASAADLRSWFGR
Download sequence
Identical sequences C6BI12
gi|241664920|ref|YP_002983280.1| 428406.Rpic12D_3344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]