SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146294151|ref|YP_001184575.1| from Shewanella putrefaciens CN-32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146294151|ref|YP_001184575.1|
Domain Number 1 Region: 140-338
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.79e-59
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000316
Further Details:      
 
Domain Number 2 Region: 425-555
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.83e-31
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000267
Further Details:      
 
Domain Number 3 Region: 8-139
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.09e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.0013
Further Details:      
 
Domain Number 4 Region: 340-415
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.13e-20
Family Duplicated SiR/NiR-like domains 1 and 3 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146294151|ref|YP_001184575.1|
Sequence length 565
Comment sulfite reductase subunit beta [Shewanella putrefaciens CN-32]
Sequence
MSEQKLALNEYLKTDSDYLRGTIKEGLDSSVTGSFSDGDQQLIKFHGFYQQDDRDLRNER
KEQKLEPLYSFMLRARVPGGICSPQQWLGVDKIASTLTSSNSIRLTTRQTFQYHGIPKRN
LKTIIQDLDRQALDSIAACGDVNRNVMCNPNPVESKLHEQAYAVAKKLSDHLLPHTRAYA
EIWLDEEKLLTTEDETVEPVYGKTYLPRKFKMAVAVPPDNDVDVYTNDLGFIAVAENGEL
VGFNLTAGGGMGSTHGEVETFPRLADDFGFIKTEDVMKFAEAVMTVQRDWGNRSNRKRSR
LKYTIVDHGYEKFKAEVEARAGVKFEPKREVVIGDRGDRYGWVEGVDGKWHLTLFIESGR
IKDLPGQTLQTGLREIAKIHKGDFRMTSNQNMIIAGVAAEDKATIEGLARKHGLLGQVLT
QTRGHSIACVALPTCPLAMAEAERYFPEFIDHIDALQAKHGISEQAIVVRMTGCPNGCAR
PFAAEIGLVGKAPGRYNLYLGASFEGTRLNKMHRENIQEADILAELDTLFGRYAVERDAG
ETFGNFTVRVGVVKAVIDAAKDFHG
Download sequence
Identical sequences A4Y9Z3
319224.Sputcn32_3063 gi|146294151|ref|YP_001184575.1| WP_011919898.1.82224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]