SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110833947|ref|YP_692806.1| from Alcanivorax borkumensis SK2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110833947|ref|YP_692806.1|
Domain Number 1 Region: 631-806
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.96e-50
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0024
Further Details:      
 
Domain Number 2 Region: 3-189
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.88e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0039
Further Details:      
 
Domain Number 3 Region: 500-639
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.29e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.011
Further Details:      
 
Domain Number 4 Region: 149-310
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.49e-23
Family FAD/NAD-linked reductases, N-terminal and central domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110833947|ref|YP_692806.1|
Sequence length 843
Comment nitrite reductase [Alcanivorax borkumensis SK2]
Sequence
MAKQQLLLIGHGMVGQRYLESLVALGGREHFDITVLCAEPLPAYDRVGLTSYFSGKTADD
LSLVPEGFFEEHGITLKLNTKVNAIDRAGKTVTTNTGETLPYDKVVLATGSYPFIPPIPG
NDRDNCFVYRTIDDLDAMIAASKNGKVGAVVGGGLLGLEAAKALHDLGLETHVVEFAPRL
MAVQVDDFGGGLLKDKIQELGVTVHTSTGTQDIVDGETCTHRMNFGDDKYLETDVIVFSA
GIRPQDELGRACELAIGERGGIVVNNQCVTSDEHIYAIGEVALWEGRIFGLVAPGYQMAE
VAAEHLIGKAEKQFAGADMSTKLKLMGVDVASIGDAHGSTPGCRSTVFMDQTAGIYKKAV
ISACGKKLLGAVLVGDAADYGNLLQLCLNEMDLPGDPAALVAPVSDGAPLLGADALPDSA
QICSCNNVSKGDLCAAIDDGAQTVGDLKACTKASATCGGCSALVKQVLDSELEKRGVEVN
NHLCEHFPYSRQEIYHLVRVGQITTFDAFLEAHGSGDGCDICKPTVANVLASCWNDWVLN
KPHAGLQDTNDYFLGNMQRDGTYSIVPRVAGGEITPDKLIVLGEVAKQYDLYTKITGGQR
VDLFGARVEQLPEIWKILVDAGFETGHAYGKSLRTVKSCVGSTWCRYGVKDSVGTAIQVE
DRYKGLRSPHKIKMAVSGCTRECAEAQSKDVGVIATEKGWNLYVCGNGGMRPRHADLFAS
DLTDEQLIKTIDRFLMFYIKTADRLQRTSVWLENLEGGLDYLKDVILNDSLGMGDELEAQ
MQHVIETYQCEWKSTIENPEAVKRFNHFINDTAEADDNLTYVRERGQRRPAYEHERIELV
EEA
Download sequence
Identical sequences Q0VQL4
WP_011588369.1.14994 WP_011588369.1.41240 WP_011588369.1.66393 WP_011588369.1.75482 393595.ABO_1086 gi|110833947|ref|YP_692806.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]