SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110834049|ref|YP_692908.1| from Alcanivorax borkumensis SK2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110834049|ref|YP_692908.1|
Domain Number 1 Region: 120-274
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.75e-47
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00019
Further Details:      
 
Domain Number 2 Region: 408-547
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 6.8e-39
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0011
Further Details:      
 
Domain Number 3 Region: 1-126
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.09e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.0099
Further Details:      
 
Domain Number 4 Region: 253-277,314-420
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.76e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110834049|ref|YP_692908.1|
Sequence length 548
Comment sulfite reductase [Alcanivorax borkumensis SK2]
Sequence
MYVYQEYDQRLLEERVAQYRDQTRRFLANELSEDEFLALRLQNGLYIQRYAPMLRISVPY
GLLASRQLRRLAHIVRTYDKGFCHVSTRQNIQLNWPCVEEVPDILAELADVQMHAIQTSG
NCIRNITTDEFAGVNPKEIEDPRPWCEIIRQWSTFNPEFAYLPRKFKIAVNAVPDADPAL
IGVHDIGVQIVHNANGETGFQVWAGGGLGRTPMTGAVIGEFVPWQDLLAYLESILRVYNK
YGNRDNKYKARIKILVKALGAEKYRELVEQEFAELKGGEMTLTSEEVARIKGCFTAPDYQ
NPDTAALQSKLAEDKAFSRWYHTNTRAHKQHGYRAVTLTLKRTGRVPGDISDDQLEAVAD
LADQYSFGELRNSHQQNMVLSDVAAHDLYDLWKALDELGFATPNLGLLTDIVACPGGDLC
ALANAKSIPIAESIQRRFDDVDYLHDLGPLDLNISGCMNACGHHHIGHIGILGVDKKGKE
FYQVTLGGRGDKLSRIGEKMGPSFESEEITDVVEKIINLYVEKRLENEPFIDTYERIGMD
PFKERIYG
Download sequence
Identical sequences Q0VQB2
gi|110834049|ref|YP_692908.1| WP_011588471.1.14994 WP_011588471.1.41240 WP_011588471.1.66393 WP_011588471.1.75482 393595.ABO_1188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]