SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110834652|ref|YP_693511.1| from Alcanivorax borkumensis SK2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110834652|ref|YP_693511.1|
Domain Number 1 Region: 229-273,306-332,422-621
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 2.51e-42
Family CoA transferase alpha subunit-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110834652|ref|YP_693511.1|
Sequence length 718
Comment acetyl-CoA hydrolase/transferase family protein [Alcanivorax borkumensis SK2]
Sequence
MTDRINQVELAVDRVIEATGGEIRLAMPLGLGKPNRFVNALYARVEADTRLSLDIYTALS
LSKPSAGSDLEKRFLNPFADRLFADYEELTYLAAQKRGNLPANIRVFEFFVQPGSILGND
VAQQHYISSNYTHVARDLNARGVNVVAQLLAHRQVDGNDEYSFSCNPEVTLDLMPLLKAR
REAGETILAVGQVHRDLPFMENDARVEEWLPEMDLLVDDPQGHTRLFSTPNMPVNIQDHF
VGLHASTLVRDGGTLQIGIGALGDALVHHLRLRDQDNPRYLKAVKAWAVPPEHEALIEQE
GGTGVFREGVYGCSEMMTHGLLTLIDDGIIRRPVYDWAPLQRLEMHNPTTPGLALLDALR
EQSAISRRLDKEQLRTLKRFGIFRNEIDKHGDELQLPNGVTVPNDLDDRTTREALKAVFG
DRLVGGVVMHGGFFLGPRDFYARLLEMSKQEHAQINMTRISFINHLYGDEILKRLQRQDA
RFVNTAFTVTLLGAVASDQIENGRVLSGVGGQYNFVSQAHELEGARSILMVRAWRERAGE
VMSNIVFSYGHNTIPRHLRDIVITEYGVADLRGKTDEEVVMAMLNVADSRFQIELMEQAQ
AAGKLREDYQIPEVHRRNNPEHLHEIAERCGKDSFPLFPLGTDFTEVEQRLLTALTWLKE
KVSHKEYLKLGRRALFHDGSPSEFAAQLKRMELNKPEGVREHIFQRLLLTALEATQEN
Download sequence
Identical sequences Q0VNK9
WP_011589072.1.14994 WP_011589072.1.41240 gi|110834652|ref|YP_693511.1| 393595.ABO_1791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]