SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154247110|ref|YP_001418068.1| from Xanthobacter autotrophicus Py2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154247110|ref|YP_001418068.1|
Domain Number 1 Region: 214-317
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.89e-26
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.012
Further Details:      
 
Domain Number 2 Region: 106-228
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 7.73e-22
Family Aromatic dioxygenase reductase-like 0.0017
Further Details:      
 
Domain Number 3 Region: 6-102
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.16e-20
Family Ferredoxin reductase FAD-binding domain-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154247110|ref|YP_001418068.1|
Sequence length 318
Comment ferredoxin [Xanthobacter autotrophicus Py2]
Sequence
MTAGDPLQVRVRDIVELAPSLKRFSFEPAHGGLFPTPPAGGHVMLTLRDGARVMKNAYSL
VSAPMDRARYDIIVRLVAQSRGGSAFLHRKVAPGDVLEMARPVSLFPLASSAKKHLLIGG
GIGITPLLSFLPELKARGARFELHQLSGGEEAPVFERLLAPYAAGEEIRVHGGGRAAFDL
AGLLSRQPLGTHVYVCGPHALMDAVTTTAAALGWPKGKVHKESFGGGGGGLPFRALLKRS
GIEVEVGESQSLLEAIEAAGVEAPCLCRGGACGECRTEVIEGEVDHRDDFLSEQEKASGK
LVLTCVSRARGPRLVLDL
Download sequence
Identical sequences A7IK68
gi|154247110|ref|YP_001418068.1| WP_012115158.1.63109 78245.Xaut_3181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]