SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154247988|ref|YP_001418946.1| from Xanthobacter autotrophicus Py2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154247988|ref|YP_001418946.1|
Domain Number 1 Region: 214-318
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 7.08e-30
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.012
Further Details:      
 
Domain Number 2 Region: 7-101
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 4.54e-26
Family Ferredoxin reductase FAD-binding domain-like 0.00025
Further Details:      
 
Domain Number 3 Region: 99-227
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.57e-16
Family Aromatic dioxygenase reductase-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154247988|ref|YP_001418946.1|
Sequence length 319
Comment ferredoxin [Xanthobacter autotrophicus Py2]
Sequence
MSDEALQSVVVAKKTVEAENMVSFELVPAEGGELAPFTPGAHLDVTIPGGLMRQYSLCNS
ASERHRYVIGVWKDANSRGGSKALFQQVNEGDRLQVGEPRNRFAVPRDVKRALLFARGIG
ATPILSIADHLKAKNIPFEFHYLFAGGSPGSFRSIIEASTFAENTSFYFEAAEPRLNPAA
LLADRPDDTHLFLCGVDWWLDPVIANAQQKGYGVNRIHVERFTAKAPPPLLDKVFDVKIA
SSGKVIKIPGDRSVTAALEEAGVKVPTSCEQGACGTCKVKVLEGEIDHRDKRLKPEEKEQ
GYFLACVSRAKGDLLVLDL
Download sequence
Identical sequences A7IMP6
WP_012116035.1.63109 78245.Xaut_4067 gi|154247988|ref|YP_001418946.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]