SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390960218|ref|YP_006424052.1| from Thermococcus sp. CL1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390960218|ref|YP_006424052.1|
Domain Number 1 Region: 193-360
Classification Level Classification E-value
Superfamily RibA-like 3.92e-58
Family RibA-like 0.00000511
Further Details:      
 
Domain Number 2 Region: 2-185
Classification Level Classification E-value
Superfamily YrdC/RibB 2.08e-46
Family 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB 0.0000864
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390960218|ref|YP_006424052.1|
Sequence length 386
Comment bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II [Thermococcus sp. CL1]
Sequence
MNWGEIRKAVLDGKPVVLIDEGREFEADLVYPAEIASSEVVNFMLSAKGLLCLTMDMDEA
LERGFFPLLSKEGETNFLVPVDYSETFTGITAEERALTARKIAEGLSVKAFRYPGHLHLL
GGVGLNRRRGHTESSLELMEFLGFKRYALIVEILDEEGDSHNRDYALNFAREHGLPVLTT
DDVWKEFVRRKQLIRVYANARLPTRYGEFRIIAFDNELDFREHVAIVKEPYGEVPLVRIH
SKCLTGDTLASLKCDCGSQLAHALMMIAQEGGILLYMDQEGRGIGLKEKIKAYELQDKGL
DTVEANDALGHKADERTYEAAFQMLRALGVSKVKLITNNPAKAKALEEFGIEVVEIIPAP
GEVTEHNRPYLRVKAEKLGHRLPFEV
Download sequence
Identical sequences I3ZRC4
gi|390960218|ref|YP_006424052.1| WP_014787899.1.33015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]