SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390960818|ref|YP_006424652.1| from Thermococcus sp. CL1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390960818|ref|YP_006424652.1|
Domain Number 1 Region: 5-243
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.94e-62
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0000323
Further Details:      
 
Domain Number 2 Region: 330-499,737-803
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 6.87e-43
Family Intein (protein splicing domain) 0.0041
Further Details:      
 
Domain Number 3 Region: 859-981,1073-1089,1326-1391
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.65e-33
Family Intein (protein splicing domain) 0.0086
Further Details:      
 
Domain Number 4 Region: 1417-1536,1711-1750
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 9.42e-32
Family Intein (protein splicing domain) 0.058
Further Details:      
 
Domain Number 5 Region: 1748-1926
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.27e-22
Family Extended AAA-ATPase domain 0.041
Further Details:      
 
Domain Number 6 Region: 573-679
Classification Level Classification E-value
Superfamily Homing endonucleases 1.57e-17
Family Intein endonuclease 0.0097
Further Details:      
 
Domain Number 7 Region: 1173-1266
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000000643
Family Group I mobile intron endonuclease 0.053
Further Details:      
 
Domain Number 8 Region: 693-749
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000067
Family SinR domain-like 0.046
Further Details:      
 
Domain Number 9 Region: 487-560
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000068
Family Intein endonuclease 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390960818|ref|YP_006424652.1|
Sequence length 2019
Comment cell division control protein, MCM family [Thermococcus sp. CL1]
Sequence
MIERYARFLREYVDDDGKEVYLNKLKDLLTVTPKRSLAIDWTHLNSFDPELAGELIENPE
ESILAAEDAIQIILREPPLLVEREFKVHARFYNLPHTLLVKELGSEHINRLIQVEGIITR
VSEVKPFVEKAVFVCKDCGNEMVRLQRPYENLVKPAKCDACGSRNIELDVEKSRFINFQS
FRLQDRPESLKGGQMPRFVDAILLDDMVDTALPGDRVLVTGILRVILEQKDKRPIFKKVL
EVNHIEQLSKEIEELEISPEDEQKIRELAKRKDIVDAIVDSIAPAIWGHRTVKKGIALAL
FGGVQRTLPDGTKLRGESHVLLVGDPGVAKCVDYHTKVLLADGSLREIGDVVEEAVRRAE
EEGKLKKVDDGFYAPIDLELYALDAKTLKVRKVRANIAWKRTAPERMYRIRTASGREIRV
TPTHPFFTFEDGQFRTRKAEELKEGCFIAVPRAIPAGGRPVKLSEVPIEKPKTAKSRLQL
PEFADEEFWYVIGLLTGEGYTQKRGSSATVYFTNNDDRLIEKVYEYFKKIGLNPTIRDPH
KGKTAKEVYASGIELYQLMKWLGIAQNLSEKKVPPQLFGARLEDVKAFLRGYFDAEATVD
RKRPKITVVSASEELLKGVQHLLLRFGIKSQLHETRSRATNGRMKTARKYYRLFITGEDA
VRFKELIGLEVSRKHKILEQVTQGMKPNTNVDIVPGVGKLLWKLRSEAGLTQKQMGINRS
TYMHYERGDRLPSREKLKIVVEALKQHLSESKELKVLELLASSDIFWDRVVEIEEYNPEH
PWVYDLQVPEHHNFIANDIFVHNSQLLRYVANLAPRAIYTSGKSSSAAGLTAAAVRDEFT
GSWVLEAGVLVLADGGFACLHPDSRVLADGKYVRIEDLFELEKSYKALSDGQVVDIQEKE
MGVTALDLGSMRTKASTATIIRRKPWKGELLRLKFRSGNEVTLTPDHLLIDGQTLEWKEA
EKFRVGDKVVAPLKLPSVRNRVYILDILPSTWKIKLTPEEKRELKAEVLKRFKSLAEFNR
KYNVSRDSLSGKGSISVGKFRKILRKLGIYDEWRERPLTYGPNYRRERLKVAYITPELAY
FLGFLYGDGWIKRDGSKVHVRIVQSKVHNRQIENLRRAFKSFYDGQLREYERTTRSELAG
NEIESNTITFHVSSPLLAYLYEYITKDNFRNAFSLDDEALKAFIAGALDSDGCVSIKSSK
RGSVVHVEFLLSNDLEMDRAFALLLRRFDVYARIVPGKGVNRIQITGREDVTNLLNAIRA
YSVKIKEIPVKKHLVSSKSDKVPAEPVSRIARDIIESVPAKLLQERGLWSTVYSYAKGRY
QPSRIQLKKLVEKLGDVLSPEIRIKLEVLATRDYFLDEIVSIERIPYDGYVYDLYVPGEH
NFLAEGIIVHNCIDEFDKMSDRDRSAIHEALEQQSYHHDFELLLADGRKVKIGELVDSLI
EANRDRVILGKDTEILPVDNVYVLAYDLERKEIVRVKADRVSRHKAPEKFIRLRFSNGRE
ITVTPEHPIMVWENGEIKEKPAAKIEIRDIVLGVSRYPLELPEVEGRRFRERKTAEDRQD
YLYSLGKVSRVKRVAGRHVVEISERRFPKEIVSHLKKAARVLGVVQLPEERAKLSRPLVG
ERVLRPYLNRVMERIALLESLAESDPAEAVELLPRSRVYALTGVTVDHLKKRAVTGDRWA
VSTIRLLVKNLLEQAKGHLERFMEYWDGNVNFLTVIKVKEVPNDRWEWVYDVTVEPYHLF
VSHGLVLHNTISISKAGITATLNSRTTVIAAANPKYGRFNRHKSLPEQLDLPPTLLSRFD
LIFLLLDEPDEKVDASIAEHILKVRRGEAEVVTPKIPYDLLKKYIAYARKNVHPVLSREA
MDEIKRYYVRMRKGFKRSGEEEGVQPIPVTARQLEALIRLSEAHARMRLSETVTREDARA
AIQIIEEMIRKIATDEEGTLDISILEVGKSSRKINKIDRLIDIIKNLESEGEFGAPEDKV
IEAAKQAGIGSENEVKKLLSDLKRDARIYEPRAGFYKVL
Download sequence
Identical sequences I3ZT24
gi|390960818|ref|YP_006424652.1| WP_014788494.1.33015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]