SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390961472|ref|YP_006425306.1| from Thermococcus sp. CL1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390961472|ref|YP_006425306.1|
Domain Number 1 Region: 59-191,532-599
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 8.37e-43
Family Intein (protein splicing domain) 0.018
Further Details:      
 
Domain Number 2 Region: 687-792,970-986,1233-1293
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.35e-28
Family Intein (protein splicing domain) 0.01
Further Details:      
 
Domain Number 3 Region: 1382-1471
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 2.14e-23
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.00000693
Further Details:      
 
Domain Number 4 Region: 600-687
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.23e-19
Family Extended AAA-ATPase domain 0.0000115
Further Details:      
 
Domain Number 5 Region: 272-360
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000000000357
Family Intein endonuclease 0.0052
Further Details:      
 
Domain Number 6 Region: 1294-1364
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000133
Family Extended AAA-ATPase domain 0.000033
Further Details:      
 
Domain Number 7 Region: 12-60
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000303
Family Extended AAA-ATPase domain 0.0002
Further Details:      
 
Domain Number 8 Region: 1067-1174
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000000125
Family Intein endonuclease 0.045
Further Details:      
 
Domain Number 9 Region: 849-928
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000321
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.081
Further Details:      
 
Domain Number 10 Region: 440-483
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000782
Family SinR domain-like 0.063
Further Details:      
 
Weak hits

Sequence:  gi|390961472|ref|YP_006425306.1|
Domain Number - Region: 974-1056
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00142
Family Group I mobile intron endonuclease 0.061
Further Details:      
 
Domain Number - Region: 184-243
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00765
Family Intein endonuclease 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390961472|ref|YP_006425306.1|
Sequence length 1473
Comment replication factor C small subunit [Thermococcus sp. CL1]
Sequence
MSAEIQEVKILEKPWVEKYRPQRLDDIVGQEHIVKRLKHYAKTGSMPHLLFAGPPGVGKC
LTGDAKVIANGELTTIGELVERIGNGRFGPTPVKGLKVLGIDEDGRLRELPVEYVYKDKT
NELVRIRTGLGRELKVTPYHPLLVNRKNGRIEWVKAEELEPGDRLAVPRFLPAVLEEDPL
AEWLGYFIGDGHADAQSNVITFTNTDAKLRKRFMELTERLFPDAKIRERLHRNRAPDVYV
NSKMAKELVKGLDLAGRKADRVYIPPRGWRGLRSFLRAYFDCDAGVERGGIVLSTASREM
VEQISYALAGLGITAKVKERRVKKRPYYYVVISGSNNVSRFLAEVGFSIEEKRRKAEALI
RNPNPNVGSLYADRELISYVRDRLKLRFSDDKARWSPEKARKISWELMKEIYYRLDELEN
LEKALSRSILIDWNQVEERRKEIAEKTGIRADRILEYVRGKRKPSLRNYLKIAKALGIDL
EETVEAMRLFARKYSSYAEIGRLVGTWNSSVRIILEGNTEKIETLEEIRKAELELLRGIL
NDEKLKRGVAYLIFLAQNELVWDEIVEIERLRGDFVIYDLHVPGYHNFIGGNLPTVLHNT
TAALALARELFGENWRHNFLELNASDERGINVIREKVKEFARTKPVAGASFKIIFLDEAD
ALTQDAQQALRRTMEMFSNNVRFILSCVTGDTRIYTPDEREVRIRDFLGHFERGLLREVS
NRAGRDTVIAAVAFNSRIVGHPVFRLTLESGRTIEATGDHMFLTPEGWVQTYDLKEGSEV
LVRPTLEGTPYEEDPRPIIDLGDFYAFLEKIEREHGLKPIGEARTFRELLTREKEKILAR
ALELKAEMENGLTAREAEVLELIPGEWISREELQRKTGLSRVRINQLLKSLEEKGYVERR
ISGKAQLVRKVREGRPLRNPMDVKRALEEEFGIRISYTTVRKLLAGEVSGMAYDILREVR
EKWLVRYDDERAGILARVLGFLLGDGHLAKGVRVWFNSGREELEMLAEDLRKLGLSPSEI
IERESGSEINGRPVKGRIHMLYVDSSAFHALMRYWGVEAGNKTRRGYRVPEWIKKGNLFV
KREFLRGLFGADGTRPSGRRYNFNGIKLEMRATRESLELTTEFFNDLSELLREFDVESRV
TVSPVGDRFIVRLVVTPNDANYLRFLSRVGYAYAKDSHARLVGEYLRIKLAYKEIVLPEL
AEKAVELATSSNPTSAARLLGVKRDFVVSRLKGKEIGLTRDFMTFEEFLRERTLDGYVVE
KVIRKENLGYLDVYDVTCARDHSFISNGLISHNCNYSSKIIEPIQSRCAIFRFRPLSDED
IAKRIRYIAENEGLELTEDGLQAILYVAEGDLRRAINVLQAAAALDRKITDENVFLVASR
ARPEDVREMMQLALEGNFLKAREKLREILLKQGLSGEDVLIQMHKEVFNLPIPEDRKVAL
ADKIGEYNFRLVEGANEMIQLEALLAQFTIMGK
Download sequence
Identical sequences I3ZUX7
WP_014789145.1.33015 gi|390961472|ref|YP_006425306.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]