SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390961871|ref|YP_006425705.1| from Thermococcus sp. CL1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390961871|ref|YP_006425705.1|
Domain Number 1 Region: 72-139
Classification Level Classification E-value
Superfamily NfeD domain-like 2.88e-16
Family NfeD domain-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390961871|ref|YP_006425705.1|
Sequence length 139
Comment hypothetical protein containing NfeD domain [Thermococcus sp. CL1]
Sequence
METLPISLLILGLLVIALDMMVTAFITPIGVAMVVLGLLMGFGVNFTESFVIALIAAMIS
YIIVGRYIKKDVQDAGKGKYTFELKGKRGKVVEIGKDHYIVELEGDRWIALSENDEKLKI
GEVVEVSEVDGVKLIVRRV
Download sequence
Identical sequences I3ZW27
WP_014789542.1.33015 gi|390961871|ref|YP_006425705.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]