SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390962133|ref|YP_006425967.1| from Thermococcus sp. CL1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390962133|ref|YP_006425967.1|
Domain Number 1 Region: 577-960
Classification Level Classification E-value
Superfamily Hypothetical protein PH1602 5.89e-147
Family Hypothetical protein PH1602 0.00000000000293
Further Details:      
 
Domain Number 2 Region: 2-97
Classification Level Classification E-value
Superfamily Hypothetical protein PH1602 3.4e-30
Family Hypothetical protein PH1602 0.00000263
Further Details:      
 
Domain Number 3 Region: 96-194,229-255,510-577
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.94e-29
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.068
Further Details:      
 
Domain Number 4 Region: 344-453
Classification Level Classification E-value
Superfamily Homing endonucleases 6.23e-16
Family Intein endonuclease 0.031
Further Details:      
 
Weak hits

Sequence:  gi|390962133|ref|YP_006425967.1|
Domain Number - Region: 247-338
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00397
Family Group I mobile intron endonuclease 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390962133|ref|YP_006425967.1|
Sequence length 960
Comment hypothetical protein CL1_1978 [Thermococcus sp. CL1]
Sequence
MVPLKRIDKIRWEIPKFDRRMRVPGRVYADDQLIEKMRGDRTLEQAANVAMLPGIYKYSI
VMPDGHQGYGFPIGGVAAFDVKEGVISPGGVGYDINCLAPGSKVLTEHGYWIRVEEMPEK
FKLQAVRVYDIDEGHNDFSGVAFVAEREVEKNELAVRIVTESGRVIEGSEDHPVLTPEGY
VYLGNIREGDEVLVYPFEGVEFEEKSGVILDEGDLEGADAQTIRFLKERNLLPLRWEDPK
IGTLARILGFAFGDGHLGEMDGRLYLSFYGKEETLRELKKDLERLGINANLHVRERDYRI
ETVSGKYEGRSVSAELRVTSRSFALLMERLGMPRGRKAETAYSVPGWIKEAPLWVKRNFL
AGLFASDGSVVEFKGNTPLPINLTQSKARELEENLREFMEEIAGILAEFGVKTTVYPVKS
RKGVTYRLALVGEESIRNFLGRINYEYDPEKKAKGLVAYAYLKFKEHIKEERRKAGETAR
KVYRETGSVSKAYEAVKDVVNRRFVERAIYEGEKEPRVPKDFPTFEEFARERGYEGGFVA
ERVVKVERVRPGYDRFYDIGVYHDAHNFIANGVVVHNCGVRLIRTNLTEKEVRPRIKELV
DTLFKNVPSGLGSKGRVRLHWTQLDDVLADGAKWAVDNGYGWKEDLEHLEEGGRMEGADP
NAVSQKAKQRGAPQLGSLGSGNHFLEVQVVDKIFDEEIAKAYGLFEGQVVVMVHTGSRGL
GHQVASDYLRIMEKANRKYGVPWPDRELVSVPFQTEEGQRYFSAMKAAANFAWANRQMIT
HWVRESFEEVFKRKAEDMEMSIVYDVAHNIAKVEEHEVDGKRVKVVVHRKGATRAFPAGH
PDVPRAYRDVGQPVLIPGSMGTASYVLAGAEGSMRETFGSSCHGAGRLLSRKAATRQYRG
DRLKSELARRGIYVRAASLRVVAEEAPGAYKSVDNVVNVVHQAGIAKLVARMRPMGVAKG
Download sequence
Identical sequences I3ZWT9
gi|390962133|ref|YP_006425967.1| WP_014789803.1.33015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]