SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390961788|ref|YP_006425622.1| from Thermococcus sp. CL1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390961788|ref|YP_006425622.1|
Domain Number 1 Region: 11-190
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.49e-30
Family Clp protease, ClpP subunit 0.013
Further Details:      
 
Domain Number 2 Region: 374-443
Classification Level Classification E-value
Superfamily NfeD domain-like 1.83e-16
Family NfeD domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390961788|ref|YP_006425622.1|
Sequence length 449
Comment hypothetical protein CL1_1631 [Thermococcus sp. CL1]
Sequence
MRPRLALIALLLAVLILQQGVSGKENVVYVARVDGMITGYTVDQFDRYISEAERANASAI
IIELNTPGGRGDAMQEIVTRIQNAKVPVIIYVHPSGGMAASAGTYIALSSHLIAMTPGTV
IGACRPILGYSTNGSIVEAPPKITNFYVAYIRELARVSGRNETLAEEFITEDRSVTPEEA
LKYGVIEVIASDVEELLQKADGMETKVPVAGKGKVTLHLRDAELMYIEPSFRDTVVKYIT
DPTIAYLLLNLGFIGLIFGFLTPGWHVPETVGAIMLVLGLLGLGYFGYESAGLLLVVLAM
IFFIAEALTPTFGLFTVAGVVTFVIGGILLFSGTGAGGEYLVTSETYSVLRIAILVMAIL
LGLFFLFGAATVVRAHRKKPEAGKEELIGEVGKVVEDVDPEGVVKLRGELWKAESRDGRR
IPVGEKVKVVEVRGLTLIVEKVDGVKEGE
Download sequence
Identical sequences I3ZVU4
gi|390961788|ref|YP_006425622.1| WP_014789459.1.33015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]