SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146280908|ref|YP_001171061.1| from Pseudomonas stutzeri A1501

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146280908|ref|YP_001171061.1|
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 4.01e-30
Family Frataxin-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146280908|ref|YP_001171061.1|
Sequence length 110
Comment frataxin-like protein [Pseudomonas stutzeri A1501]
Sequence
MSLSEARYHDLVDAVQESVEDVFDDTSLDVDLENSGGVLTVRFDNGSQLILSRQPALRQL
WVAARSGGFHFDYDEGSQLWLCDASGERLGELLTRVTQEQGGEALEFEDL
Download sequence
Identical sequences A4VGW8 F8H8J5
379731.PST_0513 WP_011911746.1.11668 WP_011911746.1.31855 WP_011911746.1.7470 WP_011911746.1.85630 WP_011911746.1.88125 WP_011911746.1.90639 WP_011911746.1.9384 gi|146280908|ref|YP_001171061.1| gi|339492627|ref|YP_004712920.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]