SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146282175|ref|YP_001172328.1| from Pseudomonas stutzeri A1501

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146282175|ref|YP_001172328.1|
Domain Number 1 Region: 42-402
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 4.23e-113
Family FMN-linked oxidoreductases 0.00000000203
Further Details:      
 
Domain Number 2 Region: 373-561
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2e-43
Family N-terminal domain of adrenodoxin reductase-like 0.00000921
Further Details:      
 
Domain Number 3 Region: 502-560,598-693
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.19e-20
Family C-terminal domain of adrenodoxin reductase-like 0.0000587
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146282175|ref|YP_001172328.1|
Sequence length 715
Comment 2,4-dienoyl-CoA reductase FadH [Pseudomonas stutzeri A1501]
Sequence
MIRKLSFMIIEREVWAVYRRCISDRSPKRLGTDNDEDTPMTAFPHLLAPLDLGFTTLRNR
TLMGSMHTGLEEMPNGFERMAAFFAERARGGVGLIVTGGVGPNEEGSVRAGAAKLSTPEE
AEEHKIVTQAVHEAGGKICMQILHAGRYAYSPQLVAPSAIQAPINPFTPRELDEEGIEKQ
IRDFVNCATLAQRAGYDGVEIMGSEGYFINQFLVAHTNHRTDRWGGSYENRMRLPVEIVR
RVREAVGPNFIIIYRLSMLDLIEGGSIWEEVVQLAKAIEQAGATLINTGIGWHEARIPTI
ATKVPRAAFTKVTAKLRGEVNVPLITTNRINTPEVAEQVLAEGDADMVSMARPFLADPEF
VNKAAAGHSERINTCIGCNQACLDHTFSGKLTTCLVNPRACYETELNYIPTTAVKKIAVV
GAGPAGLAAATVAAERGHQVTLFDAASEIGGQFNVAKRVPGKEEFYETLRYFQNRLEETG
VEVRLNTRATAEALLAGGFDEIILATGIVPRTPEIPGIDHPKVIGYLDAILERKPVGQRV
AVIGAGGIGFDVSEYITHDGQSTSLDREAFWKEWGIDLGLSVRGGIAGIQPAPHAPKRQV
YLLQRKKSKVGNGLGKTTGWIHRTGLKNKHVQMLNSVEYLLIDDAGLHIRVGEGEPQVLP
VDTVILCAGQEPLRELQQTLEAAGARVHLIGGADVAAELDAKRAINQGCRLAAAL
Download sequence
Identical sequences A4VKI5
gi|146282175|ref|YP_001172328.1| 379731.PST_1812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]