SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146280939|ref|YP_001171092.1| from Pseudomonas stutzeri A1501

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146280939|ref|YP_001171092.1|
Domain Number 1 Region: 3-322
Classification Level Classification E-value
Superfamily FMN-binding split barrel 8.24e-125
Family UbiD middle domain-like 0.000000000273
Further Details:      
 
Domain Number 2 Region: 323-487
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 4.05e-66
Family UbiD C-terminal domain-like 0.0000000567
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146280939|ref|YP_001171092.1|
Sequence length 488
Comment 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Pseudomonas stutzeri A1501]
Sequence
MQYRDLRDFISGLEKRGELKRVTAAVSPVLEMTEICDRTLRKQGPALLFENPTGFDMPVL
GNLFGTPGRVALGMGAEDVSELREIGKLLAFLKEPEPPKGLKDAWSKLPIYKKVISMAPK
VLKDAPCQEVIVEGDDVDLTKIPVQHCWPGDAAPLITWGLTITKGPNKERQNLGIYRQQV
IGRNKVIMRWLSHRGGALDFREWCEKYPDRPYPVAVALGADPATILGAVTPVPDTLSEYA
FAGLLRGSRTELVKAIGSELQVPAYAEIVLEGHIHPGEMADEGPYGDHTGYYNEVDRFPV
FTVERITHRKNPIYHSTYTGRPPDEPAILGVALNEVFVPILQKQFPEIVDFYLPPEGCSY
RMAVVTMKKQYPGHAKRVMLGVWSFLRQFMYTKFVIVTDDDINARDWNDVIWAITTRMDP
KRDTVMIDNTPIDYLDFASPISGLGSKMGLDATHKWPGETNREWGRAIVQDPAVKRRVDE
LWLQLGID
Download sequence
Identical sequences A0A0T8KU65 A4VGZ9
gi|146280939|ref|YP_001171092.1| 379731.PST_0544 WP_011911777.1.31855 WP_011911777.1.7470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]