SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110798674|ref|YP_694786.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110798674|ref|YP_694786.1|
Domain Number 1 Region: 74-155
Classification Level Classification E-value
Superfamily Methylated DNA-protein cysteine methyltransferase, C-terminal domain 2.88e-33
Family Methylated DNA-protein cysteine methyltransferase, C-terminal domain 0.0000919
Further Details:      
 
Domain Number 2 Region: 9-80
Classification Level Classification E-value
Superfamily Methylated DNA-protein cysteine methyltransferase domain 0.000000000000981
Family Methylated DNA-protein cysteine methyltransferase domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110798674|ref|YP_694786.1|
Sequence length 158
Comment methylated-DNA-[protein]-cysteine S-methyltransferase [Clostridium perfringens ATCC 13124]
Sequence
MKESLIKKGYYNSPIGILEIIESDGHIVEINFVEDDNCLEEFISEEIEKCKIELEEYFSG
RRSEFSVKVDLAKGTEFQRKVWNALRDIPYGETVSYKEIAEKIGNPKAVRAVGGANNKNP
IPIIIPCHRVIGKDGSLTGYGGGLSKKECLLNLENENK
Download sequence
Identical sequences A0A0H2YPP3
WP_011590144.1.20964 WP_011590144.1.30163 WP_011590144.1.50147 WP_011590144.1.52260 WP_011590144.1.5234 WP_011590144.1.52659 WP_011590144.1.68380 195103.CPF_0326 gi|110798674|ref|YP_694786.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]