SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110798679|ref|YP_696405.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110798679|ref|YP_696405.1|
Domain Number 1 Region: 7-168
Classification Level Classification E-value
Superfamily RNase III domain-like 8.72e-50
Family RNase III catalytic domain-like 0.0000352
Further Details:      
 
Domain Number 2 Region: 119-235
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 3.14e-22
Family Double-stranded RNA-binding domain (dsRBD) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110798679|ref|YP_696405.1|
Sequence length 241
Comment ribonuclease III [Clostridium perfringens ATCC 13124]
Sequence
MNFKVKDINLIEVEKLIGIEFENKGVLITALTHSSYANQFKDVKYNERLEFLGDSVLQLC
VTKYLFNNYKDKSEGELTKIRALVVCENSLHKVSKNLSLGKYIRMSKGEELTGGRERTSI
QADALEAVIAAVYLDKGIEVANDFILRNFKDVIDKAINEEIILDFKTRLQEVLQKNGEVN
IVYNLVKHEGPPHRRKFFTDLLINNEIMGQGVGFSKKESEQNAAKAALQRLGEIKWEKDT
I
Download sequence
Identical sequences A0A0H2YPP8 A0A133NE99
WP_011590937.1.100517 WP_011590937.1.10161 WP_011590937.1.1075 WP_011590937.1.13323 WP_011590937.1.1394 WP_011590937.1.14338 WP_011590937.1.17789 WP_011590937.1.2058 WP_011590937.1.20964 WP_011590937.1.22226 WP_011590937.1.27360 WP_011590937.1.27537 WP_011590937.1.28470 WP_011590937.1.28529 WP_011590937.1.29129 WP_011590937.1.29428 WP_011590937.1.30163 WP_011590937.1.31832 WP_011590937.1.3228 WP_011590937.1.32463 WP_011590937.1.35472 WP_011590937.1.39851 WP_011590937.1.4345 WP_011590937.1.4402 WP_011590937.1.44743 WP_011590937.1.48074 WP_011590937.1.4818 WP_011590937.1.50147 WP_011590937.1.50713 WP_011590937.1.51349 WP_011590937.1.52260 WP_011590937.1.5234 WP_011590937.1.52659 WP_011590937.1.5667 WP_011590937.1.64066 WP_011590937.1.66593 WP_011590937.1.68380 WP_011590937.1.76352 WP_011590937.1.78174 WP_011590937.1.81392 WP_011590937.1.83225 WP_011590937.1.85755 WP_011590937.1.87374 WP_011590937.1.93653 WP_011590937.1.96543 WP_011590937.1.98368 WP_011590937.1.99566 195103.CPF_1972 gi|110798679|ref|YP_696405.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]