SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110798708|ref|YP_695922.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110798708|ref|YP_695922.1|
Domain Number 1 Region: 6-252
Classification Level Classification E-value
Superfamily MetI-like 8.78e-55
Family MetI-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110798708|ref|YP_695922.1|
Sequence length 260
Comment ABC transporter permease [Clostridium perfringens ATCC 13124]
Sequence
MKKSKVLTTFVVLVYIFLFAPLVIIAMTSIGTENYIAFPPKGFSLQWFITVFKSESFIKS
MGTSFLISTVSTLSALVIGMPAAYGLSRYNFKGKDILKSFFFSPLIVPGIVVGFSLFQFL
LVKMNLSVYASLFIGHTLIIIPYIIRVVGSSLEGFDYSIEEAAMSLGCKKSQTFFKVVLP
NITSGVMAAFMLAFINSFNNVPVSIFLTGPGVSTLPTTMMNYVEYNYDPTVSALSVILMI
LTIGIMYILEKTLGLNNFAG
Download sequence
Identical sequences A0A0H2YPE0 A0A127EIP6
WP_003467290.1.100517 WP_003467290.1.10161 WP_003467290.1.1075 WP_003467290.1.13323 WP_003467290.1.1394 WP_003467290.1.14338 WP_003467290.1.17789 WP_003467290.1.2058 WP_003467290.1.20964 WP_003467290.1.23119 WP_003467290.1.27360 WP_003467290.1.28470 WP_003467290.1.28529 WP_003467290.1.29129 WP_003467290.1.29428 WP_003467290.1.30163 WP_003467290.1.3228 WP_003467290.1.39851 WP_003467290.1.43003 WP_003467290.1.4345 WP_003467290.1.44743 WP_003467290.1.48074 WP_003467290.1.4818 WP_003467290.1.50147 WP_003467290.1.51349 WP_003467290.1.52260 WP_003467290.1.5234 WP_003467290.1.52659 WP_003467290.1.64066 WP_003467290.1.66593 WP_003467290.1.67534 WP_003467290.1.68380 WP_003467290.1.76352 WP_003467290.1.78174 WP_003467290.1.83225 WP_003467290.1.85755 WP_003467290.1.87374 WP_003467290.1.93653 WP_003467290.1.96543 WP_003467290.1.99566 gi|110798708|ref|YP_695922.1| 195103.CPF_1479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]