SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110798718|ref|YP_695180.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110798718|ref|YP_695180.1|
Domain Number 1 Region: 2-199
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.5e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0023
Further Details:      
 
Domain Number 2 Region: 155-317
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.59e-32
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0036
Further Details:      
 
Domain Number 3 Region: 432-543
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.27e-31
Family Multidomain sulfurtransferase (rhodanese) 0.02
Further Details:      
 
Domain Number 4 Region: 322-446
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.41e-30
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110798718|ref|YP_695180.1|
Sequence length 566
Comment pyridine nucleotide-disulfide oxidoreductase [Clostridium perfringens ATCC 13124]
Sequence
MSKKIVIVGGVAGGASTAARLRRLDENNQIIMFERGPHVSFSNCCLPYYLSGKVENHEDL
VLMTPEKFYSQYRIDARVYTEVVSINRKAKEVTVRNVVSGQEYTESYDKLVLSPGAKAIV
PPIKGIEDVNVFTVRNVVDIAKLDSFIKDNNSKNISVIGGGFIGVEVAENLHEAGYNVTL
IEAMDQIMKPFDYDMVQVLHKEMYDKGVNLIVGDKVSSFESGKVVLESGKKINSDAVVMA
IGVAPETDLAREAGLEIGQTGAIKVNQNYLTNDKDIYAVGDAVEVYNSLTNSISRLPLAG
PAQKQARAVADHIHGRPSRNSGYIGSSCVQIFDYNGASTGLTEGQIKAMNLSLNYDVVRV
IPQDKVGLMPGSEPLHFKLIFEVPTGRILGAQAIGKGNADKRVDIIATLIKMGGTVEDLK
DLELCYAPPFGTAKDVVNHAALVASNLLEGTFKQVYVHEVRDLVESGACIIDVREVSEYE
AGHIKGAKNLPLSEIRDRLDEIPTDRPVYLHCRSAQRSYNACLALQHLGFDNIYNVSGGF
MGISFYEYYNDKVQDREPIVTEYNFN
Download sequence
Identical sequences A0A0H2YPE9 A0A174DFB6
gi|110798718|ref|YP_695180.1| 195103.CPF_0728 NYSGXRC-11162g NYSGXRC-13538a WP_003472186.1.23119 WP_003472186.1.50147 WP_003472186.1.81392 WP_003472186.1.98368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]