SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110798722|ref|YP_697021.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110798722|ref|YP_697021.1|
Domain Number 1 Region: 143-307
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.41e-44
Family Histidine kinase 0.00023
Further Details:      
 
Domain Number 2 Region: 73-152
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000000235
Family Homodimeric domain of signal transducing histidine kinase 0.0031
Further Details:      
 
Domain Number 3 Region: 35-85
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000131
Family HAMP domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110798722|ref|YP_697021.1|
Sequence length 310
Comment sensor histidine kinase [Clostridium perfringens ATCC 13124]
Sequence
MQNELVFLDIVNKIILGIGVLLILASTIMGFIISRSITRPINKLMTKAKYISKGEYDKKI
EINTDILEINDLINSINNLSQSIKEQENIRKRLTGDISHELKTPLTNIQSHLEAMIDGIW
EPTEERLLSVKEEAERLSSLVSDMQKLNKYDESSIKLKKDNVNISDIICFVIFQFSNLAK
SKNIKIEYEKKNINLYCDKDKITQALVNILSNAIRYSNEGSTIFIEEKLKDNKVIISIED
QGIGISEEDLKYVFERFYRADKSRTRATGGTGIGLTIVKSIVSSHGGEVKLESKLGEGSK
FTIILPKEDI
Download sequence
Identical sequences A0A0H2YNS7
195103.CPF_2640 gi|110798722|ref|YP_697021.1| IDP04304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]