SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110798792|ref|YP_696773.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110798792|ref|YP_696773.1|
Domain Number 1 Region: 1-261
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.23e-67
Family Phosphate binding protein-like 0.0000745
Further Details:      
 
Domain Number 2 Region: 295-493
Classification Level Classification E-value
Superfamily MetI-like 2.75e-44
Family MetI-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110798792|ref|YP_696773.1|
Sequence length 502
Comment His/Glu/Gln/Arg/opine amino acid ABC transporter amino acid-binding protein/permease [Clostridium perfringens ATCC 13124]
Sequence
MKKKLMLLFLTISILMMVLVGCSNNSNNIQKNSTNKEKITVATSGTYYPFTFLEGGELKG
FEVDVWNEIGKRLGYDVEFKTASFSGLFGMLESGKVNTIANQITVTPEREEKYYFSEPYV
YSGAQIIVKKGNDSIKSFDDLKGKKVGVDLGSNYEKIVKDKDENNEIKILTYQNTDAAFN
ELLLGRIDAVVIDRVSAIAAIKEKDLNLQLAGEPIDKIENAYPFVKDEKGKDLSENVNKA
LDEMKKDGTLKSISEKWLGMNVSVPNNQENSNNIIDNNKNNSIGFDFMYSLDLIPMLLKA
INVTISLSVFGMILGLIVGIALAMIRVYKIPVLKQIAEVYISFFRGTPLLVQLFLLYFGV
PQVIPSLQNMSAFTAALIGLGLNASAYIAEILRSSIDAIDKGQMEACLSLGMTRAQALKR
VVLPQAFRIAIPPLGNIFVDTVKGSSLAFTLGVVELLAKAQMEAAASYKFFESYVVVAIM
YWIIIGFFNYLQKILEKKLSVY
Download sequence
Identical sequences A0A0H2YPK5 A0A173X148 B1R3H6
WP_003455090.1.100517 WP_003455090.1.10161 WP_003455090.1.2058 WP_003455090.1.20964 WP_003455090.1.22226 WP_003455090.1.27257 WP_003455090.1.27537 WP_003455090.1.30163 WP_003455090.1.39851 WP_003455090.1.50147 WP_003455090.1.50713 WP_003455090.1.52260 WP_003455090.1.5234 WP_003455090.1.52659 WP_003455090.1.5667 WP_003455090.1.68380 WP_003455090.1.81392 WP_003455090.1.90682 WP_003455090.1.98368 gi|110798792|ref|YP_696773.1| 195103.CPF_2350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]