SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110798794|ref|YP_696271.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110798794|ref|YP_696271.1|
Domain Number 1 Region: 46-144
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.31e-28
Family Single-domain sulfurtransferase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110798794|ref|YP_696271.1|
Sequence length 150
Comment rhodanese domain-containing protein [Clostridium perfringens ATCC 13124]
Sequence
MKRISLLLLSLTLTASLFVGCGNNNTENKDANTQTSSESSSETQSEAVSKDISIDESKKL
INDGEVTLILDVRNEDEFAEGHLKNAIQIPVKELKENLSDIEKFKDELVLVYCRSGKRSA
EAVDILKENGFKNLVHMKDGISKWDGEVEK
Download sequence
Identical sequences A0A0H2YQ08 A0A173Z7D1 B1BGF4 B1R4Z2 B1V4S3 Q8XK18
WP_003449631.1.100517 WP_003449631.1.10161 WP_003449631.1.2058 WP_003449631.1.20964 WP_003449631.1.22226 WP_003449631.1.23119 WP_003449631.1.24595 WP_003449631.1.27257 WP_003449631.1.27537 WP_003449631.1.30163 WP_003449631.1.31832 WP_003449631.1.32463 WP_003449631.1.39851 WP_003449631.1.4402 WP_003449631.1.50147 WP_003449631.1.50713 WP_003449631.1.51349 WP_003449631.1.52260 WP_003449631.1.5234 WP_003449631.1.52659 WP_003449631.1.5667 WP_003449631.1.68380 WP_003449631.1.81392 WP_003449631.1.98368 195102.CPE1585 195103.CPF_1837 gi|18310567|ref|NP_562501.1| gi|110798794|ref|YP_696271.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]