SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110798799|ref|YP_694840.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110798799|ref|YP_694840.1|
Domain Number 1 Region: 5-247,333-393
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.45e-51
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.00017
Further Details:      
 
Domain Number 2 Region: 220-329
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 7.92e-35
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0000815
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110798799|ref|YP_694840.1|
Sequence length 439
Comment L-aspartate oxidase [Clostridium perfringens ATCC 13124]
Sequence
MKRVADVLIVGSGVAGLYASLNLREDLEIIMVSKKSVNLCNSSLAQGGIAVARGKEDFQS
FIEDTLKAGKYENNIDSVRVLVEESMDNINKLIDLGANFEKDENGVLFTKEGAHEINRIV
YHKDITGKHVEDILLENVKRRKNIKIIEDCEMVDIYHRDNRCIGALFNKDGETLSIYAKV
VILATGGIGGLFKKSTNERIITGDSIGVAIRNNIEIKDLSYIQIHPTAFFSKKSEEKRFL
ISESVRGEGGKLINCNGERFVDELLPRDIVSKKIYEEMKKTNSNNVFLDVSFMEKSFLQN
RFPNIYNKCLEEGIDISKEPIPVAPAQHYFMGGIKVDLNGKTSMENLYAFGETSCTGVHG
ANRLASNSLLEALVFSRRGALEINSYIDNLELIIEERECEDLDKYRLLNRKILIDEICRL
RGDIKDELVTCGGECKKSS
Download sequence
Identical sequences A0A0H2YNI1
195103.CPF_0383 gi|110798799|ref|YP_694840.1| WP_011590170.1.27257 WP_011590170.1.50147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]