SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110798806|ref|YP_697177.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110798806|ref|YP_697177.1|
Domain Number 1 Region: 1-251
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.02e-62
Family UDP-glucose pyrophosphorylase 0.00000369
Further Details:      
 
Domain Number 2 Region: 249-452
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 2.19e-52
Family GlmU C-terminal domain-like 0.00000923
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110798806|ref|YP_697177.1|
Sequence length 454
Comment bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase [Clostridium perfringens ATCC 13124]
Sequence
MNKCAIILAAGQGTRIKSKLPKVLHKACGKEMVNHVIDAMRNAEIDDVNVIIGKGAELVK
ERTTSRNVSYSLQAEQLGTGHAVKCAKDFLEGKTGVVAIFTGDAPLIKPETVKNLVDTHI
NEKNSATLLTSVIENPTGYGRIVRNGESVEKIVEHKDCNEQEIKIQEINAGMYCFDIESL
LTSLEQLSNDNAQGEYYLTDVIEILKKENKKVGAMITDFEETLGVNSRAELAKVESIMRN
RINRTHLDNGVTIIDPLNTYIEPEVVIGKDTIIYPGNVIEGKTVIGEDCVLYPNSRINNS
TIGNGVEIQSSVILDSKIGDETTVGPFAYVRPESNIGEHVRIGDFVEIKKSTIGNNTKVS
HLTYIGDAEVGERCNFGCGTVVVNYDGKKKHKTIIGDDSFIGCNTNLVSPVEVKDNTYIA
AGSTITKEVPEGSLAIARAKQQNIEGWVERKKLK
Download sequence
Identical sequences B1R601 Q0TMG3
gi|110798806|ref|YP_697177.1| 195103.CPF_2813 WP_003456738.1.20964 WP_003456738.1.27257 WP_003456738.1.27537 WP_003456738.1.30163 WP_003456738.1.50147 WP_003456738.1.52260 WP_003456738.1.5234 WP_003456738.1.52659 WP_003456738.1.68380 WP_003456738.1.98368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]