SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110798815|ref|YP_696781.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110798815|ref|YP_696781.1|
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Hypothetical protein TT1725 1.26e-31
Family Hypothetical protein TT1725 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110798815|ref|YP_696781.1|
Sequence length 96
Comment hypothetical protein CPF_2358 [Clostridium perfringens ATCC 13124]
Sequence
MRVLNLKITLRASWVHSLKEKRMVVKSIVQRLKNKFNVSVGEVHEQDIHQIIVIGISAVC
GDQKQVDSTLENLIDFVEENTDAEIINIESDNYIFK
Download sequence
Identical sequences A0A0H2YNY9 B1BIB4 B1R3I4 I1SBA2 Q0SR83 Q9XDT9
WP_003451429.1.100517 WP_003451429.1.10161 WP_003451429.1.2058 WP_003451429.1.20964 WP_003451429.1.22226 WP_003451429.1.23119 WP_003451429.1.24595 WP_003451429.1.27257 WP_003451429.1.27537 WP_003451429.1.30163 WP_003451429.1.32463 WP_003451429.1.39851 WP_003451429.1.50147 WP_003451429.1.51349 WP_003451429.1.52260 WP_003451429.1.5234 WP_003451429.1.52659 WP_003451429.1.5667 WP_003451429.1.68380 195102.CPE2101 195103.CPF_2358 289380.CPR_2065 gi|110803587|ref|YP_699374.1| gi|110798815|ref|YP_696781.1| gi|18311083|ref|NP_563017.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]