SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110798905|ref|YP_695966.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110798905|ref|YP_695966.1|
Domain Number 1 Region: 587-754
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.54e-43
Family Histidine kinase 0.00035
Further Details:      
 
Domain Number 2 Region: 383-503
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.05e-18
Family Heme-binding PAS domain 0.055
Further Details:      
 
Domain Number 3 Region: 514-598
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.75e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110798905|ref|YP_695966.1|
Sequence length 787
Comment sensory box histidine kinase [Clostridium perfringens ATCC 13124]
Sequence
MLIGLFNNLGIKEKTLKRIAIVTVILLSLFFIKGLNLICALNRDLFKDVSVVYAAEEIIV
MTQIILCIMILSICFIYYRGLKRKEFFGISLVYVSIITEMIFIVLTGKIVENQVYDLNLF
SLLFRGILLLLAVLCLENFDAFIRKYKKLTLVFVILVTIILQILNVNYNIGIYTYNFIYN
LTLVLIVLTYISCIIFCLVRIFQFREITYLVIMISASLMLLKLVYGLSLSITNNNLIKIN
IVFFNFISFMSFVFGMFFDLLQVIKNKNFMQEELSAFFNLIEFDCNSEVVVLSNNLKVLY
ANEKCRSKRISPKNRENKTYIDLEKQIKGFLYDKNIICIESVLRNSKEWKGIIKLNEEDE
VVKVNLQRIKKEKNLYYVLRINDITEEYKMEKNLKLEEQRLRGVTENIKDLIFTIDVEGK
ISYVNKAVIDVLGYSEEELIGKNYYDLLLVESNLNIIDSKYFNEDKILTIDKVRSKKGLV
QLESISSRIKDNKNNTLGWVRVARNIEDVREIEILKNKFEEIKQYDKVRSEFFANLSHEL
RTPINIIYSCIQLLNTSKKNKANFANLYDKYEKTLKQNCFRMLRLVNNLIDITKIDSGFI
KMDFINYDIIKLTEDITMSVIPYVESKNIDIIFDTNCEELEIRCDPDKIERIILNLLSNA
IKFTEPGGKIEVSIFADETWVDIRVKDTGIGIPSHMKEFIFERFIQNDKSLNRNKEGSGI
GLSLVKSLVELHEGKVFLRESNESGSEFSILLPNVKLENDVCENGSLDYKTEVEKISIEF
ADIYEIY
Download sequence
Identical sequences A0A0H2YPS1
195103.CPF_1523 IDP04365 gi|110798905|ref|YP_695966.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]