SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110798942|ref|YP_697173.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110798942|ref|YP_697173.1|
Domain Number 1 Region: 1-183
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 1.07e-66
Family Peptidyl-tRNA hydrolase-like 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110798942|ref|YP_697173.1|
Sequence length 188
Comment peptidyl-tRNA hydrolase [Clostridium perfringens ATCC 13124]
Sequence
MILIVGLGNPGKQYEQTRHNIGFDVIDYMANKYNIDVNREKFKGICGEGFIENKKVILLK
PLTYMNLSGESIRELANFYKLEDDEIIVVYDDISLDIGRLRIREKGSAGGHNGIKSIIQN
LGGDKFPRVKVGVGQPKDNLVNHVLGKFSKEDREHIEKVIPVVSDAIVEIVKNDAKESMN
KFNGVNIE
Download sequence
Identical sequences A0A140GTQ7 B1BHV5 B1BS98 B1R5Z6 B1V006 Q0TMG7 Q8XHJ8
195102.CPE2485 195103.CPF_2808 WP_003450588.1.100517 WP_003450588.1.1075 WP_003450588.1.13323 WP_003450588.1.1394 WP_003450588.1.14338 WP_003450588.1.17789 WP_003450588.1.20964 WP_003450588.1.22226 WP_003450588.1.23119 WP_003450588.1.24595 WP_003450588.1.27360 WP_003450588.1.27537 WP_003450588.1.28470 WP_003450588.1.28529 WP_003450588.1.29129 WP_003450588.1.29428 WP_003450588.1.30163 WP_003450588.1.31832 WP_003450588.1.3228 WP_003450588.1.32463 WP_003450588.1.35472 WP_003450588.1.39851 WP_003450588.1.43003 WP_003450588.1.4345 WP_003450588.1.4402 WP_003450588.1.44743 WP_003450588.1.48074 WP_003450588.1.4818 WP_003450588.1.50147 WP_003450588.1.50713 WP_003450588.1.51349 WP_003450588.1.52260 WP_003450588.1.52659 WP_003450588.1.5667 WP_003450588.1.64066 WP_003450588.1.66593 WP_003450588.1.67534 WP_003450588.1.68380 WP_003450588.1.76352 WP_003450588.1.78174 WP_003450588.1.81392 WP_003450588.1.83225 WP_003450588.1.85755 WP_003450588.1.87374 WP_003450588.1.90682 WP_003450588.1.93653 WP_003450588.1.96543 WP_003450588.1.98368 WP_003450588.1.99566 gi|110798942|ref|YP_697173.1| gi|18311467|ref|NP_563401.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]