SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110798993|ref|YP_694487.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110798993|ref|YP_694487.1|
Domain Number 1 Region: 119-420
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.99e-104
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000152
Further Details:      
 
Domain Number 2 Region: 1-115
Classification Level Classification E-value
Superfamily tRNA-binding arm 3.98e-29
Family Seryl-tRNA synthetase (SerRS) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110798993|ref|YP_694487.1|
Sequence length 425
Comment seryl-tRNA synthetase [Clostridium perfringens ATCC 13124]
Sequence
MLDLKKLRSNTEEVKKALSNRGEDFDVNVIDEVIALDEERRKILVDVEALKKQRNEVSAE
IPKRKKAGEDVTEVMAEMREIGGKIKADDAKVAELNDKINYIMLRIPNIPNPAVPEGETD
EDNVEIKRWGEPTKFNFEPKAHWDLGTDLDLLDFERGGKVAGSRFTVYKGMGARLERSII
NYFLDKHTFENGYTEVLPPYMVNRDSMTGTGQLPKFEEDAFKVENNGYFLIPTAEVPVTN
MYRNETLEGDKLPIKHAAYSACFRAEAGSAGRDTRGLIRQHQFNKVELVKFCKPEQSYEE
LDKLVQDAESVLQGLGLPYRIVRICKGDLGFTAALKYDIEVWMPSYNRYVEISSCSNFED
FQARRANIKYKNSPKEKPQFVHTLNGSGVAIGRTVAAILENYQQEDGSVVIPEALKEYMR
CDLLK
Download sequence
Identical sequences Q0TV53
WP_011590028.1.50147 gi|110798993|ref|YP_694487.1| 195103.CPF_0014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]