SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110798994|ref|YP_695847.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110798994|ref|YP_695847.1|
Domain Number 1 Region: 312-477
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.36e-39
Family Histidine kinase 0.00063
Further Details:      
 
Domain Number 2 Region: 247-321
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000177
Family Homodimeric domain of signal transducing histidine kinase 0.0012
Further Details:      
 
Domain Number 3 Region: 196-243
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000667
Family HAMP domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110798994|ref|YP_695847.1|
Sequence length 478
Comment sensor histidine kinase [Clostridium perfringens ATCC 13124]
Sequence
MKKFNLGKNRYKVSNILLRNYLKVFLLITIITATIFLISFIIGVSIYLKSEPIENESSKI
LAGEIENKDYNSIGNQDYVTEHGGWIEIIDKDLNIIETIGDQKVKRDNYSSEEFSKILVD
EMHGVNIDEDYLSYTGYSKEGRFFVITRIPEENFGKMFTRNPKIGFKIFVYIMISLYIFI
FTMSLILYSKLTSKTFTKPLDKLMNGVRKLSLGDYSTRINIEKNNEFEELGEAFNNMASK
IEEEKKLKEKSEKLRKEFVRNIAHDLKTPLSSIIGYSNIIKNNPDIEKESLHKYISVIEN
NGERANEMIMELFEFYTLQSSEFILHKKYQDLSEFLRNLIADYIYLLEEKDFDFDFEISE
DDLYLEFDNKRLERAIGNLIINSVKYNKKGTKFLISLKKEGDKVKIIVSDDGIGLSEEIK
KHIFNPFVREEKSRNSKKGGSGLGLTISKEIVEKHGGTIYLSDGPLKGCNFVIELPIK
Download sequence
Identical sequences A0A0H2YQH4
195103.CPF_1402 WP_011590694.1.50147 GO.11673 IDP04247 gi|110798994|ref|YP_695847.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]