SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799041|ref|YP_697065.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799041|ref|YP_697065.1|
Domain Number 1 Region: 50-171
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 8.76e-43
Family Insert subdomain of RNA polymerase alpha subunit 0.0000489
Further Details:      
 
Domain Number 2 Region: 6-50,172-225
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 2.35e-30
Family RNA polymerase alpha subunit dimerisation domain 0.00087
Further Details:      
 
Domain Number 3 Region: 248-313
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 1.7e-23
Family C-terminal domain of RNA polymerase alpha subunit 0.0000652
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110799041|ref|YP_697065.1|
Sequence length 315
Comment DNA-directed RNA polymerase subunit alpha [Clostridium perfringens ATCC 13124]
Sequence
MLEIEKPVIQCVESNDNGTYGKFEIEPLERGYGITLGNALRRILLSSLPGVAPTSVKIDS
VLHEFSTITGVKEDVTEIILNLKMLALTMEGEGPKTIYIDAQGPGVVTGADIKTDGDVEV
VNKDLHIATLDNDGKLYMEIVVNRGRGYVTQNKNKTEDLPLSAIAIDSIYTPVKRVNFSV
QNTRVGQITDYDKLTLEIWTNGTIRIEEAISLSAKILIEHFKLFMTLTDNANDVEIMIEK
EEDKKEKALEMTIEELDLSVRSYNCLKRAGINTVQELAGKSMDDMMKVRNLGKKSLEEVE
RKLNELGLNLRLNDE
Download sequence
Identical sequences A0A133N968 B1BMK7 B1BQN4 B1RBN0 B1V788 P0C2E6 Q0SQH3 Q0TMS5
WP_003454404.1.100517 WP_003454404.1.10161 WP_003454404.1.1075 WP_003454404.1.13323 WP_003454404.1.1394 WP_003454404.1.14338 WP_003454404.1.17789 WP_003454404.1.20964 WP_003454404.1.22226 WP_003454404.1.23119 WP_003454404.1.24595 WP_003454404.1.27257 WP_003454404.1.27360 WP_003454404.1.27537 WP_003454404.1.28470 WP_003454404.1.28529 WP_003454404.1.29129 WP_003454404.1.29428 WP_003454404.1.30163 WP_003454404.1.31832 WP_003454404.1.3228 WP_003454404.1.32463 WP_003454404.1.35472 WP_003454404.1.39851 WP_003454404.1.43003 WP_003454404.1.4345 WP_003454404.1.4402 WP_003454404.1.44743 WP_003454404.1.48074 WP_003454404.1.4818 WP_003454404.1.50147 WP_003454404.1.50713 WP_003454404.1.51349 WP_003454404.1.52260 WP_003454404.1.5234 WP_003454404.1.52659 WP_003454404.1.5667 WP_003454404.1.64066 WP_003454404.1.66593 WP_003454404.1.67534 WP_003454404.1.68380 WP_003454404.1.76352 WP_003454404.1.78174 WP_003454404.1.81392 WP_003454404.1.83225 WP_003454404.1.85755 WP_003454404.1.87374 WP_003454404.1.90682 WP_003454404.1.93653 WP_003454404.1.96543 WP_003454404.1.98368 WP_003454404.1.99566 195102.CPE2376 195103.CPF_2685 289380.CPR_2370 gi|110802435|ref|YP_699634.1| gi|18311358|ref|NP_563292.1| gi|110799041|ref|YP_697065.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]