SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799105|ref|YP_696815.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799105|ref|YP_696815.1|
Domain Number 1 Region: 30-85
Classification Level Classification E-value
Superfamily Cell division protein MinE topological specificity domain 0.000000000405
Family Cell division protein MinE topological specificity domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110799105|ref|YP_696815.1|
Sequence length 90
Comment cell division topological specificity factor MinE [Clostridium perfringens ATCC 13124]
Sequence
MSFLNVFSSRPTPKQVAKDRLKVILIHDRGELSDEVLDKIRLEILDVLSKYVEIENEDVD
ITVTKSNPIEGESPSLVANIPIKNIKGKAR
Download sequence
Identical sequences A0A133NCS3 B1BKF8 B1BRY8 B1R3L7 B1UYW7 Q0TNH5 Q8XII2
gi|18311119|ref|NP_563053.1| WP_003452508.1.100517 WP_003452508.1.10161 WP_003452508.1.1075 WP_003452508.1.13323 WP_003452508.1.1394 WP_003452508.1.14338 WP_003452508.1.17789 WP_003452508.1.2058 WP_003452508.1.20964 WP_003452508.1.22226 WP_003452508.1.23119 WP_003452508.1.24595 WP_003452508.1.27257 WP_003452508.1.27360 WP_003452508.1.27537 WP_003452508.1.28470 WP_003452508.1.28529 WP_003452508.1.29129 WP_003452508.1.29428 WP_003452508.1.30163 WP_003452508.1.3228 WP_003452508.1.32463 WP_003452508.1.35472 WP_003452508.1.39851 WP_003452508.1.43003 WP_003452508.1.4345 WP_003452508.1.44743 WP_003452508.1.48074 WP_003452508.1.4818 WP_003452508.1.50147 WP_003452508.1.50713 WP_003452508.1.51349 WP_003452508.1.52260 WP_003452508.1.5234 WP_003452508.1.52659 WP_003452508.1.5667 WP_003452508.1.64066 WP_003452508.1.66593 WP_003452508.1.67534 WP_003452508.1.68380 WP_003452508.1.76352 WP_003452508.1.78174 WP_003452508.1.81392 WP_003452508.1.83225 WP_003452508.1.85755 WP_003452508.1.87374 WP_003452508.1.90682 WP_003452508.1.93653 WP_003452508.1.96543 WP_003452508.1.98368 WP_003452508.1.99566 IDP04101 195102.CPE2137 195103.CPF_2392 gi|110799105|ref|YP_696815.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]