SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799110|ref|YP_694688.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799110|ref|YP_694688.1|
Domain Number 1 Region: 326-464
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.01e-22
Family Histidine kinase 0.0055
Further Details:      
 
Domain Number 2 Region: 244-324
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000294
Family Homodimeric domain of signal transducing histidine kinase 0.0029
Further Details:      
 
Domain Number 3 Region: 201-250
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000000119
Family HAMP domain 0.0085
Further Details:      
 
Weak hits

Sequence:  gi|110799110|ref|YP_694688.1|
Domain Number - Region: 75-160
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00667
Family Sensory domain of two-component sensor kinase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110799110|ref|YP_694688.1|
Sequence length 476
Comment sensor histidine kinase [Clostridium perfringens ATCC 13124]
Sequence
MKNNKIQINLNLKQKIILTNLLILAPIIIFIFIITYNALSKNLINNSIEYLLDKSRTTES
YILNLLSSNDSGDKEDIIRDNAPFIASTLSEKYNVRIQIISNSAQIIYDSSSDEVSLFGS
DINESLDGQTAYIVEKIDNVPTLFLSSPIFYKGKEYGAIRLILINTEAYEILRNTLTIFI
ISGLIAIVIAIFLINTFAKELVSPLMILKQKSKNISEGKFKEELHITSGDEVEDLANTFN
IMSENLDKYINEIKSAKLHQKKFFDNVSHEFKTPLTAIIGFSEIIPKLNDKEKIVQSSAL
IEKEGKRLLNLVEEILLLAKSNKNTFEIEYTYIDVKSLIEDCLKILKIKLDNYDIKVYRN
YESFFIYGDHDKTKQVFINIIDNAIKYSGCETLSISTKRSPNKMEVIIEDDGTGFIIKDE
YVNPKGNGLGIKICKDIMQSQNYGFNIESELDVGTKVTLSFSIGKNNEIKEEDFNE
Download sequence
Identical sequences A0A0H2YP95 A0A1U9V4U9 B1R890
195103.CPF_0225 gi|110799110|ref|YP_694688.1| WP_003458297.1.10161 WP_003458297.1.2058 WP_003458297.1.20964 WP_003458297.1.27537 WP_003458297.1.30163 WP_003458297.1.31832 WP_003458297.1.4402 WP_003458297.1.50147 WP_003458297.1.52260 WP_003458297.1.5234 WP_003458297.1.52659 WP_003458297.1.68380 IDP04189 NYSGRC-FDAO-ABG82744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]