SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799132|ref|YP_697155.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799132|ref|YP_697155.1|
Domain Number 1 Region: 10-319
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 8.42e-89
Family FMN-linked oxidoreductases 0.00000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110799132|ref|YP_697155.1|
Sequence length 326
Comment dihydrouridine synthase [Clostridium perfringens ATCC 13124]
Sequence
MKISNIVLENNVFLAPMAGVTDISFRGLCKEMGAGIVCTEMVSAKALYYGSENTKELMRI
ADEEKPVSCQMFGNDPEIMAYVTEKHFNTNDDICIIDVNMGCPAPKIVKNGEGSALMKNP
KLAYEIMSSIKKVATKPVTVKFRMGFDEENINAVEFAKIMEEAGVDAIAVHGRTRAQMYE
GKANWDIIRQVKEAVNIPVIGNGDVFTAEDALSLKNQTNCDGIMVARGSMGNPWIFKQIV
QKLNGEEVYMPTPEEKIDMCIRHYNLSLKYDGEYKAVREMRKHAAWYIKGLNNCTEVKNR
LNLEADPEKIMGILNEYKEYLMKNDL
Download sequence
Identical sequences A0A0H2YQB1 A0A133N480 B1BV66 B1R9X2 B1V4Q1 Q0SQ84 Q8XHL6
gi|110799132|ref|YP_697155.1| 195102.CPE2467 195103.CPF_2783 289380.CPR_2469 WP_003459360.1.100517 WP_003459360.1.10161 WP_003459360.1.1075 WP_003459360.1.13323 WP_003459360.1.1394 WP_003459360.1.14338 WP_003459360.1.17789 WP_003459360.1.2058 WP_003459360.1.20964 WP_003459360.1.22226 WP_003459360.1.23119 WP_003459360.1.27257 WP_003459360.1.27360 WP_003459360.1.27537 WP_003459360.1.28470 WP_003459360.1.28529 WP_003459360.1.29129 WP_003459360.1.29428 WP_003459360.1.30163 WP_003459360.1.31832 WP_003459360.1.3228 WP_003459360.1.32463 WP_003459360.1.35472 WP_003459360.1.39851 WP_003459360.1.43003 WP_003459360.1.4345 WP_003459360.1.4402 WP_003459360.1.44743 WP_003459360.1.48074 WP_003459360.1.4818 WP_003459360.1.50147 WP_003459360.1.50713 WP_003459360.1.51349 WP_003459360.1.52260 WP_003459360.1.5234 WP_003459360.1.52659 WP_003459360.1.5667 WP_003459360.1.64066 WP_003459360.1.66593 WP_003459360.1.67534 WP_003459360.1.68380 WP_003459360.1.76352 WP_003459360.1.78174 WP_003459360.1.81392 WP_003459360.1.83225 WP_003459360.1.85755 WP_003459360.1.87374 WP_003459360.1.90682 WP_003459360.1.93653 WP_003459360.1.96543 WP_003459360.1.98368 WP_003459360.1.99566 gi|18311449|ref|NP_563383.1| gi|110803269|ref|YP_699723.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]