SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799162|ref|YP_697238.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799162|ref|YP_697238.1|
Domain Number 1 Region: 1-322
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.87e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110799162|ref|YP_697238.1|
Sequence length 417
Comment pyridine nucleotide-disulfide family oxidoreductase [Clostridium perfringens ATCC 13124]
Sequence
MKYDLVVVGGGPAGLAAAYEAHENGVEKILIIERDKELGGILNQCIHNGFGLHTFKEELT
GPEYAGRFIDMVEGTNIEVMLDTMVLEIEGKIIHAINTEKGYLTIEAEAIVLAMGCRERT
RGAISIPGDRPSGIFTAGAAQRFINMEGYMVGKKVVILGSGDIGLIMARRMTLEGAKVEA
VVELMPYSNGLTRNIVQCLEDYGIPLYLSHTVIDVKGDGRLEKVIIAKVDENRQPIKGTE
IEFDADTLLLSVGLIPENELSKNAGVELDLRTNGLVVSESMETNREGIFACGNVVHVHDL
VDFVTEEAKNAGKNAAKYIKGKKRLNHFTEIKNGENISYTVPQKFEIESLDGNLNVFMRV
RNVFKNKQIVVRDEEGNVIQSFKKPHVVPAEMERITILKDKLKNAKGAITISLEDGE
Download sequence
Identical sequences A0A0H2YQX8 A0A174GFF1 B1BHP1 B1R661
WP_003450714.1.100517 WP_003450714.1.10161 WP_003450714.1.2058 WP_003450714.1.20964 WP_003450714.1.22226 WP_003450714.1.23119 WP_003450714.1.24595 WP_003450714.1.27257 WP_003450714.1.27537 WP_003450714.1.30163 WP_003450714.1.31832 WP_003450714.1.39851 WP_003450714.1.43003 WP_003450714.1.4402 WP_003450714.1.50147 WP_003450714.1.51349 WP_003450714.1.52260 WP_003450714.1.5234 WP_003450714.1.52659 WP_003450714.1.5667 WP_003450714.1.68380 WP_003450714.1.81392 195103.CPF_2874 gi|110799162|ref|YP_697238.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]