SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799177|ref|YP_695828.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799177|ref|YP_695828.1|
Domain Number 1 Region: 2-297
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 5.13e-82
Family FMN-linked oxidoreductases 0.000000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110799177|ref|YP_695828.1|
Sequence length 299
Comment dihydroorotate dehydrogenase 1B [Clostridium perfringens ATCC 13124]
Sequence
MLKTVINGVDFKNPVIAASGTFGFGAEYNSFYDVGELGGISSKGLTLNSREGNEGIRIYE
TPQGIMNSVGLQNPGIEKFIEVELPKMLELGTNIIANVGGATIEDYEKAVSLLNKEKIDM
IELNISCPNVKSGGMAFGIQSDVAYEVVSKVRKICDKPLMVKLSPNAENICNMAYRCAEA
GADSISLINTLKGMAIDIKNRKPVFNNVYAGLSGPAVKPIALRMVHEVAKTVDIPVIGLG
GISTAEDAIEFMMAGASAIQIGTINFVNPKAGIEIIKGLEDFCKKEGLKNINEIVGCIK
Download sequence
Identical sequences A0A0H2YPS6
NYSGRC-FDAO-ABG82811 gi|110799177|ref|YP_695828.1| WP_011590685.1.43003 WP_011590685.1.50147 195103.CPF_1382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]