SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799232|ref|YP_696432.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799232|ref|YP_696432.1|
Domain Number 1 Region: 183-393
Classification Level Classification E-value
Superfamily CoaB-like 1.44e-73
Family CoaB-like 0.00000842
Further Details:      
 
Domain Number 2 Region: 1-180
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 1.44e-62
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0000717
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110799232|ref|YP_696432.1|
Sequence length 395
Comment bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase [Clostridium perfringens ATCC 13124]
Sequence
MKDKKCVVVGVSGGVAVYKALDVISRLRKKDVEVHVIMTKSATEFVTPLSFQSLSQNMVI
TDMFAEPKAWEIQHISLAKKADLMLIVPATANIIGKVANGIADDMLSTTIMATKAPVVFC
PAMNTNMYENPIVQRNISLLKELGYEFIEPASGRLACGDEGKGKLQDTEIIAEETLRRLH
STKDLLGKKVVVTAGPTMVPIDPVRILTNRSSGKMGYSIAEEARDRGAEVVLISGPTSLR
KPNGIKVIDIKTNEDMFNAIKNEFKDADIVIKSAAVADYKAKNYSNEKIKKTGDDLNLIF
ERDRDILKTLGDMKENQILVGFAAESSNLKENAKGKLERKNLDYIVANDISKPETGFASD
ENKVTIISKSGEEVSLEKMSKREVAKNIFDIIKGR
Download sequence
Identical sequences A0A0H2YPR6 B1V494
gi|110799232|ref|YP_696432.1| WP_003471651.1.20964 WP_003471651.1.27257 WP_003471651.1.30163 WP_003471651.1.50147 WP_003471651.1.50713 WP_003471651.1.52260 WP_003471651.1.5234 WP_003471651.1.52659 WP_003471651.1.68380 WP_003471651.1.98368 195103.CPF_1999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]