SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799292|ref|YP_697128.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799292|ref|YP_697128.1|
Domain Number 1 Region: 5-305
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.17e-47
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110799292|ref|YP_697128.1|
Sequence length 312
Comment thioredoxin-disulfide reductase [Clostridium perfringens ATCC 13124]
Sequence
MDKEIKELDLIIIGAGPAGLTSAIYASRAKLSTLVLEDNLVGGQVRSTYTVENYPGFTEI
TGNDLADRIQAQAEACGAIIDEFDFIENVSLKDDEKIIETGDYIYKPKAVIIATGATPKK
LPIPSESKYLGKGVHYCAVCDGAVYQDEVVAVVGGGNAALEEALYLSNIVKKVIVIRRYD
YFRAEAKTLEAASNKENIEIMYNWDLVDVLGGEFVEAARIKNTKTGEEKEIAINGVFGYI
GTEPKTSMFREYINVKENGYIEGDENMRTNVKGVYVAGDVREKMFRQITTAVSDGTIAAL
HAEKYISEIKER
Download sequence
Identical sequences A0A0H2YPY9 A0A133N9B4 B1BK33 B1BV38 B1R9Z9 Q0SQA9 Q8XHP2
gi|110799292|ref|YP_697128.1| gi|110801661|ref|YP_699698.1| 195102.CPE2440 195103.CPF_2750 289380.CPR_2436 WP_003452248.1.100517 WP_003452248.1.1075 WP_003452248.1.13323 WP_003452248.1.1394 WP_003452248.1.14338 WP_003452248.1.17789 WP_003452248.1.20964 WP_003452248.1.22226 WP_003452248.1.23119 WP_003452248.1.24595 WP_003452248.1.27360 WP_003452248.1.27537 WP_003452248.1.28470 WP_003452248.1.28529 WP_003452248.1.29129 WP_003452248.1.29428 WP_003452248.1.30163 WP_003452248.1.31832 WP_003452248.1.3228 WP_003452248.1.32463 WP_003452248.1.35472 WP_003452248.1.39851 WP_003452248.1.43003 WP_003452248.1.4345 WP_003452248.1.4402 WP_003452248.1.44743 WP_003452248.1.48074 WP_003452248.1.4818 WP_003452248.1.50147 WP_003452248.1.52260 WP_003452248.1.5234 WP_003452248.1.52659 WP_003452248.1.5667 WP_003452248.1.64066 WP_003452248.1.66593 WP_003452248.1.67534 WP_003452248.1.68380 WP_003452248.1.76352 WP_003452248.1.78174 WP_003452248.1.83225 WP_003452248.1.85755 WP_003452248.1.87374 WP_003452248.1.90682 WP_003452248.1.93653 WP_003452248.1.96543 WP_003452248.1.98368 WP_003452248.1.99566 gi|18311422|ref|NP_563356.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]