SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799299|ref|YP_697043.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799299|ref|YP_697043.1|
Domain Number 1 Region: 1-284
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1e-32
Family FAD/NAD-linked reductases, N-terminal and central domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110799299|ref|YP_697043.1|
Sequence length 286
Comment thioredoxin reductase [Clostridium perfringens ATCC 13124]
Sequence
MSERYDIAIIGSGPAGLSAALNAKIRNKKFILFGNNDLSTKLVKAPKVNNYLGFVGKDGM
DLKNQFMGHLKEMDIEITEERINSIYAMGEYFALMVNEKMYEATSIIIATGIEYTKPMKG
EEEFLGKGVGYCATCDAPLYKEKTVTIIGYNKEAEEEANFVSELAAKVYYIPRYKGEFDL
NSEIEVINDIPVEIQGDSKVTKLVTKNGEIETDGIFVLRDSISPGQLVPGLKITDDHIEV
DRLMKTNIEGCFAAGDCTGRPYQYMKAAGEGNVAALSAVAYLDSKK
Download sequence
Identical sequences A0A0H2YPZ4 A0A140GTE6 B1R7N0 B1V413 Q0SQJ3 Q8XHX2
gi|110803653|ref|YP_699614.1| gi|18311336|ref|NP_563270.1| gi|110799299|ref|YP_697043.1| 195102.CPE2354 195103.CPF_2663 289380.CPR_2349 WP_003457940.1.100517 WP_003457940.1.10161 WP_003457940.1.1075 WP_003457940.1.13323 WP_003457940.1.1394 WP_003457940.1.14338 WP_003457940.1.17789 WP_003457940.1.2058 WP_003457940.1.20964 WP_003457940.1.27257 WP_003457940.1.27360 WP_003457940.1.27537 WP_003457940.1.28470 WP_003457940.1.28529 WP_003457940.1.29129 WP_003457940.1.29428 WP_003457940.1.30163 WP_003457940.1.3228 WP_003457940.1.32463 WP_003457940.1.39851 WP_003457940.1.43003 WP_003457940.1.4345 WP_003457940.1.44743 WP_003457940.1.48074 WP_003457940.1.4818 WP_003457940.1.50147 WP_003457940.1.50713 WP_003457940.1.52260 WP_003457940.1.5234 WP_003457940.1.52659 WP_003457940.1.64066 WP_003457940.1.66593 WP_003457940.1.67534 WP_003457940.1.68380 WP_003457940.1.76352 WP_003457940.1.78174 WP_003457940.1.81392 WP_003457940.1.83225 WP_003457940.1.85755 WP_003457940.1.87374 WP_003457940.1.93653 WP_003457940.1.96543 WP_003457940.1.98368 WP_003457940.1.99566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]