SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799310|ref|YP_697117.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799310|ref|YP_697117.1|
Domain Number 1 Region: 10-237,402-473
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.27e-101
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0011
Further Details:      
 
Domain Number 2 Region: 218-380
Classification Level Classification E-value
Superfamily YbaK/ProRS associated domain 2.09e-32
Family YbaK/ProRS associated domain 0.0026
Further Details:      
 
Domain Number 3 Region: 458-564
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.62e-30
Family Anticodon-binding domain of Class II aaRS 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110799310|ref|YP_697117.1|
Sequence length 570
Comment prolyl-tRNA synthetase [Clostridium perfringens ATCC 13124]
Sequence
MKMSNMLVGTLREVPAEAEIESHKLMLRAGLMRKMAAGIYNYMPLGLKVIENVKNIVREE
MNNAGAQEFLASALIPAELWQESGRWDAYGAEMFRLKDRHNRDFCLGPTHEEVFTDIVRN
EIKSYKQLPLNLYQIQTKYRDERRPRFGVMRSREFIMKDGYSFDKDQEGLDLAYEKMRKA
YVNIFNRCGLDAKAVAADSGAIGGSGSAEFMVKSEVGEDDVVFCTACDYAANIEKAPSTP
EHAEKEELMEVEKVETPAVKSIEDLAKFFECSPKKIAKTLIFQADDKVVAVVLRGDREAN
EVKIANAIGEVIELEMASEEAVKEATGAAVGFAGPMGIKVDMLLVDQEVANMYNFIIGAN
ETDMHLKNVNYGRDFEGIVGDFRNVTIGEKCPECGKEITISRGTEVGHIFKLGTKYSESM
GATFIDEDGKAKPFIMGCYGIGVTRTVASIIEQHNDENGIIWPLEVAPYHVSVIPANVKN
EEQATKAEEIYNELRKMGVEALLDDRKERAGVKFKDSELMGIPMRITVGKMIGEGQVEFK
LRNGGEVETLSIEEVYNRVREEFERANLSL
Download sequence
Identical sequences A0A174HYK4 B1RA11 Q0TMM3
195103.CPF_2738 gi|110799310|ref|YP_697117.1| WP_003459370.1.100517 WP_003459370.1.10161 WP_003459370.1.2058 WP_003459370.1.20964 WP_003459370.1.27257 WP_003459370.1.27537 WP_003459370.1.30163 WP_003459370.1.31832 WP_003459370.1.43003 WP_003459370.1.4402 WP_003459370.1.50147 WP_003459370.1.52260 WP_003459370.1.5234 WP_003459370.1.52659 WP_003459370.1.5667 WP_003459370.1.68380 WP_003459370.1.81392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]