SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799339|ref|YP_695711.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799339|ref|YP_695711.1|
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 4.58e-47
Family Methylglyoxal synthase, MgsA 0.0000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110799339|ref|YP_695711.1|
Sequence length 119
Comment methylglyoxal synthase [Clostridium perfringens ATCC 13124]
Sequence
MKIALIAHDKKKEEMIELAKDFEDKLSKHILVATGTTGLKVMQNTSLDVKRCKSGPLGGD
QEIGAMVANHDVDMVIFLRDPLTAQPHEPDISALLRLCDVYKVPLATNTESAKLIMADI
Download sequence
Identical sequences A0A1U9V7D5 B1V6G9 Q0TRM9
gi|110799339|ref|YP_695711.1| 195103.CPF_1265 WP_003476019.1.10161 WP_003476019.1.2058 WP_003476019.1.20964 WP_003476019.1.22226 WP_003476019.1.27257 WP_003476019.1.30163 WP_003476019.1.50147 WP_003476019.1.50713 WP_003476019.1.51349 WP_003476019.1.52260 WP_003476019.1.5234 WP_003476019.1.52659 WP_003476019.1.5667 WP_003476019.1.68380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]